PDB entry 4f38

View 4f38 on RCSB PDB site
Description: Crystal structure of geranylgeranylated RhoA in complex with RhoGDI in its active GPPNHP-bound form
Class: cell cycle/chaperone
Keywords: RhoA, RhoGDI, active GPPNHP bound form, CELL CYCLE-CHAPERONE complex
Deposited on 2012-05-09, released 2012-05-23
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-08-15, with a file datestamp of 2012-08-10.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.206
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transforming protein rhoa
    Species: Mus musculus [TaxId:10090]
    Gene: Rhoa, Arha, Arha2
    Database cross-references and differences (RAF-indexed):
    • PDB 4F38
    Domains in SCOPe 2.05: d4f38a_
  • Chain 'B':
    Compound: rho GDP-dissociation inhibitor 1
    Species: Mus musculus [TaxId:10090]
    Gene: Arhgdia, C87222, Gdi1
    Database cross-references and differences (RAF-indexed):
    • PDB 4F38 (Start-203)
    Domains in SCOPe 2.05: d4f38b_
  • Heterogens: GER, MG, GNP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4f38A (A:)
    ghmaairkklvivgdgacgktcllivfskdqfpevyvptvfenyvadievdgkqvelalw
    dtagqedydrlrplsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvgnk
    kdlrndehtrrelakmkqepvkpeegrdmanrigafgymecsaktkdgvrevfematraa
    lqarrgkkksgclvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4f38A (A:)
    maairkklvivgdgacgktcllivfskdqfpevyvptvfenyvadievdgkqvelalwdt
    agqedydrlrplsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvgnkkd
    lrndehtrrelakmkqepvkpeegrdmanrigafgymecsaktkdgvrevfematraalq
    arrgkkksgc
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4f38B (B:)
    gaeqeptaeqlaqiaaeneedehsvnykppaqksiqeiqeldkddeslrkykeallgrva
    vsadpnvpnvvvtrltlvcstapgpleldltgdlesfkkqsfvlkegveyrikisfrvnr
    eivsgmkyiqhtyrkgvkidktdymvgsygpraeeyefltpmeeapkgmlargsyniksr
    ftdddrtdhlswewnltikkewkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4f38B (B:)
    taeqlaqiaaenvnykppaqksiqeiqeldkddeslrkykeallgrvavsadpnvpnvvv
    trltlvcstapgpleldltgdlesfkkqsfvlkegveyrikisfrvnreivsgmkyiqht
    yrkgvkidktdymvgsygpraeeyefltpmeeapkgmlargsyniksrftdddrtdhlsw
    ewnltikkewkd