PDB entry 4f2n

View 4f2n on RCSB PDB site
Description: Crystal structure of iron superoxide dismutase from Leishmania major
Class: oxidoreductase
Keywords: SSGCID, NIH, NIAID, SBRI, Emerald Biostructures, Structural Genomics, National Institute of Allergy and Infectious Diseases, Seattle Structural Genomics Center for Infectious Disease, OXIDOREDUCTASE
Deposited on 2012-05-08, released 2012-05-16
The last revision prior to the SCOPe 2.03 freeze date was dated 2012-05-16, with a file datestamp of 2012-05-11.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.175
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: superoxide dismutase
    Species: Leishmania major [TaxId:5664]
    Gene: FESODA, LMJF_08_0290
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4f2na1, d4f2na2
  • Chain 'B':
    Compound: superoxide dismutase
    Species: Leishmania major [TaxId:5664]
    Gene: FESODA, LMJF_08_0290
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4f2nb1, d4f2nb2
  • Chain 'C':
    Compound: superoxide dismutase
    Species: Leishmania major [TaxId:5664]
    Gene: FESODA, LMJF_08_0290
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4f2nc1, d4f2nc2
  • Chain 'D':
    Compound: superoxide dismutase
    Species: Leishmania major [TaxId:5664]
    Gene: FESODA, LMJF_08_0290
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4f2nd1, d4f2nd2
  • Chain 'E':
    Compound: superoxide dismutase
    Species: Leishmania major [TaxId:5664]
    Gene: FESODA, LMJF_08_0290
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4f2ne1, d4f2ne2
  • Chain 'F':
    Compound: superoxide dismutase
    Species: Leishmania major [TaxId:5664]
    Gene: FESODA, LMJF_08_0290
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4f2nf1, d4f2nf2
  • Chain 'G':
    Compound: superoxide dismutase
    Species: Leishmania major [TaxId:5664]
    Gene: FESODA, LMJF_08_0290
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4f2ng1, d4f2ng2
  • Chain 'H':
    Compound: superoxide dismutase
    Species: Leishmania major [TaxId:5664]
    Gene: FESODA, LMJF_08_0290
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4f2nh1, d4f2nh2
  • Chain 'I':
    Compound: superoxide dismutase
    Species: Leishmania major [TaxId:5664]
    Gene: FESODA, LMJF_08_0290
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4f2ni1, d4f2ni2
  • Chain 'J':
    Compound: superoxide dismutase
    Species: Leishmania major [TaxId:5664]
    Gene: FESODA, LMJF_08_0290
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4f2nj1, d4f2nj2
  • Chain 'K':
    Compound: superoxide dismutase
    Species: Leishmania major [TaxId:5664]
    Gene: FESODA, LMJF_08_0290
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4f2nk1, d4f2nk2
  • Chain 'L':
    Compound: superoxide dismutase
    Species: Leishmania major [TaxId:5664]
    Gene: FESODA, LMJF_08_0290
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4f2nl1, d4f2nl2
  • Heterogens: FE2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4f2nA (A:)
    mfgrapmkaatataavgfsclcyhtlphlrypaelptlgfnykdgiqpvmsprqlelhys
    khhsayvdklntlgkgyegktieeiilattgineskvmfnqaaqhfnhsffwkclspggk
    pmpktlenaiakqfgsvddfmvsfqqagvnnfgsgwtwlcvdpqtkellidstsnagcpl
    tsglrpiftadvwehayykdfenrradylkelwqivdwefvchmyeratk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4f2nA (A:)
    cyhtlphlrypaelptlgfnykdgiqpvmsprqlelhyskhhsayvdklntlgkgyegkt
    ieeiilattgineskvmfnqaaqhfnhsffwkclspggkpmpktlenaiakqfgsvddfm
    vsfqqagvnnfgsgwtwlcvdpqtkellidstsnagcpltsglrpiftadvwehayykdf
    enrradylkelwqivdwefvchmyeratk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4f2nB (B:)
    mfgrapmkaatataavgfsclcyhtlphlrypaelptlgfnykdgiqpvmsprqlelhys
    khhsayvdklntlgkgyegktieeiilattgineskvmfnqaaqhfnhsffwkclspggk
    pmpktlenaiakqfgsvddfmvsfqqagvnnfgsgwtwlcvdpqtkellidstsnagcpl
    tsglrpiftadvwehayykdfenrradylkelwqivdwefvchmyeratk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4f2nB (B:)
    lcyhtlphlrypaelptlgfnykdgiqpvmsprqlelhyskhhsayvdklntlgkgyegk
    tieeiilattgineskvmfnqaaqhfnhsffwkclspggkpmpktlenaiakqfgsvddf
    mvsfqqagvnnfgsgwtwlcvdpqtkellidstsnagcpltsglrpiftadvwehayykd
    fenrradylkelwqivdwefvchmyeratk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4f2nC (C:)
    mfgrapmkaatataavgfsclcyhtlphlrypaelptlgfnykdgiqpvmsprqlelhys
    khhsayvdklntlgkgyegktieeiilattgineskvmfnqaaqhfnhsffwkclspggk
    pmpktlenaiakqfgsvddfmvsfqqagvnnfgsgwtwlcvdpqtkellidstsnagcpl
    tsglrpiftadvwehayykdfenrradylkelwqivdwefvchmyeratk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4f2nC (C:)
    cyhtlphlrypaelptlgfnykdgiqpvmsprqlelhyskhhsayvdklntlgkgyegkt
    ieeiilattgineskvmfnqaaqhfnhsffwkclspggkpmpktlenaiakqfgsvddfm
    vsfqqagvnnfgsgwtwlcvdpqtkellidstsnagcpltsglrpiftadvwehayykdf
    enrradylkelwqivdwefvchmyeratk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4f2nD (D:)
    mfgrapmkaatataavgfsclcyhtlphlrypaelptlgfnykdgiqpvmsprqlelhys
    khhsayvdklntlgkgyegktieeiilattgineskvmfnqaaqhfnhsffwkclspggk
    pmpktlenaiakqfgsvddfmvsfqqagvnnfgsgwtwlcvdpqtkellidstsnagcpl
    tsglrpiftadvwehayykdfenrradylkelwqivdwefvchmyeratk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4f2nD (D:)
    lcyhtlphlrypaelptlgfnykdgiqpvmsprqlelhyskhhsayvdklntlgkgyegk
    tieeiilattgineskvmfnqaaqhfnhsffwkclspggkpmpktlenaiakqfgsvddf
    mvsfqqagvnnfgsgwtwlcvdpqtkellidstsnagcpltsglrpiftadvwehayykd
    fenrradylkelwqivdwefvchmyeratk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4f2nE (E:)
    mfgrapmkaatataavgfsclcyhtlphlrypaelptlgfnykdgiqpvmsprqlelhys
    khhsayvdklntlgkgyegktieeiilattgineskvmfnqaaqhfnhsffwkclspggk
    pmpktlenaiakqfgsvddfmvsfqqagvnnfgsgwtwlcvdpqtkellidstsnagcpl
    tsglrpiftadvwehayykdfenrradylkelwqivdwefvchmyeratk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4f2nE (E:)
    cyhtlphlrypaelptlgfnykdgiqpvmsprqlelhyskhhsayvdklntlgkgyegkt
    ieeiilattgineskvmfnqaaqhfnhsffwkclspggkpmpktlenaiakqfgsvddfm
    vsfqqagvnnfgsgwtwlcvdpqtkellidstsnagcpltsglrpiftadvwehayykdf
    enrradylkelwqivdwefvchmyeratk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4f2nF (F:)
    mfgrapmkaatataavgfsclcyhtlphlrypaelptlgfnykdgiqpvmsprqlelhys
    khhsayvdklntlgkgyegktieeiilattgineskvmfnqaaqhfnhsffwkclspggk
    pmpktlenaiakqfgsvddfmvsfqqagvnnfgsgwtwlcvdpqtkellidstsnagcpl
    tsglrpiftadvwehayykdfenrradylkelwqivdwefvchmyeratk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4f2nF (F:)
    lcyhtlphlrypaelptlgfnykdgiqpvmsprqlelhyskhhsayvdklntlgkgyegk
    tieeiilattgineskvmfnqaaqhfnhsffwkclspggkpmpktlenaiakqfgsvddf
    mvsfqqagvnnfgsgwtwlcvdpqtkellidstsnagcpltsglrpiftadvwehayykd
    fenrradylkelwqivdwefvchmyeratk
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4f2nG (G:)
    mfgrapmkaatataavgfsclcyhtlphlrypaelptlgfnykdgiqpvmsprqlelhys
    khhsayvdklntlgkgyegktieeiilattgineskvmfnqaaqhfnhsffwkclspggk
    pmpktlenaiakqfgsvddfmvsfqqagvnnfgsgwtwlcvdpqtkellidstsnagcpl
    tsglrpiftadvwehayykdfenrradylkelwqivdwefvchmyeratk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4f2nG (G:)
    cyhtlphlrypaelptlgfnykdgiqpvmsprqlelhyskhhsayvdklntlgkgyegkt
    ieeiilattgineskvmfnqaaqhfnhsffwkclspggkpmpktlenaiakqfgsvddfm
    vsfqqagvnnfgsgwtwlcvdpqtkellidstsnagcpltsglrpiftadvwehayykdf
    enrradylkelwqivdwefvchmyeratk
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4f2nH (H:)
    mfgrapmkaatataavgfsclcyhtlphlrypaelptlgfnykdgiqpvmsprqlelhys
    khhsayvdklntlgkgyegktieeiilattgineskvmfnqaaqhfnhsffwkclspggk
    pmpktlenaiakqfgsvddfmvsfqqagvnnfgsgwtwlcvdpqtkellidstsnagcpl
    tsglrpiftadvwehayykdfenrradylkelwqivdwefvchmyeratk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4f2nH (H:)
    lcyhtlphlrypaelptlgfnykdgiqpvmsprqlelhyskhhsayvdklntlgkgyegk
    tieeiilattgineskvmfnqaaqhfnhsffwkclspggkpmpktlenaiakqfgsvddf
    mvsfqqagvnnfgsgwtwlcvdpqtkellidstsnagcpltsglrpiftadvwehayykd
    fenrradylkelwqivdwefvchmyeratk
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >4f2nI (I:)
    mfgrapmkaatataavgfsclcyhtlphlrypaelptlgfnykdgiqpvmsprqlelhys
    khhsayvdklntlgkgyegktieeiilattgineskvmfnqaaqhfnhsffwkclspggk
    pmpktlenaiakqfgsvddfmvsfqqagvnnfgsgwtwlcvdpqtkellidstsnagcpl
    tsglrpiftadvwehayykdfenrradylkelwqivdwefvchmyeratk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4f2nI (I:)
    cyhtlphlrypaelptlgfnykdgiqpvmsprqlelhyskhhsayvdklntlgkgyegkt
    ieeiilattgineskvmfnqaaqhfnhsffwkclspggkpmpktlenaiakqfgsvddfm
    vsfqqagvnnfgsgwtwlcvdpqtkellidstsnagcpltsglrpiftadvwehayykdf
    enrradylkelwqivdwefvchmyeratk
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >4f2nJ (J:)
    mfgrapmkaatataavgfsclcyhtlphlrypaelptlgfnykdgiqpvmsprqlelhys
    khhsayvdklntlgkgyegktieeiilattgineskvmfnqaaqhfnhsffwkclspggk
    pmpktlenaiakqfgsvddfmvsfqqagvnnfgsgwtwlcvdpqtkellidstsnagcpl
    tsglrpiftadvwehayykdfenrradylkelwqivdwefvchmyeratk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4f2nJ (J:)
    lcyhtlphlrypaelptlgfnykdgiqpvmsprqlelhyskhhsayvdklntlgkgyegk
    tieeiilattgineskvmfnqaaqhfnhsffwkclspggkpmpktlenaiakqfgsvddf
    mvsfqqagvnnfgsgwtwlcvdpqtkellidstsnagcpltsglrpiftadvwehayykd
    fenrradylkelwqivdwefvchmyeratk
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >4f2nK (K:)
    mfgrapmkaatataavgfsclcyhtlphlrypaelptlgfnykdgiqpvmsprqlelhys
    khhsayvdklntlgkgyegktieeiilattgineskvmfnqaaqhfnhsffwkclspggk
    pmpktlenaiakqfgsvddfmvsfqqagvnnfgsgwtwlcvdpqtkellidstsnagcpl
    tsglrpiftadvwehayykdfenrradylkelwqivdwefvchmyeratk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4f2nK (K:)
    cyhtlphlrypaelptlgfnykdgiqpvmsprqlelhyskhhsayvdklntlgkgyegkt
    ieeiilattgineskvmfnqaaqhfnhsffwkclspggkpmpktlenaiakqfgsvddfm
    vsfqqagvnnfgsgwtwlcvdpqtkellidstsnagcpltsglrpiftadvwehayykdf
    enrradylkelwqivdwefvchmyeratk
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4f2nL (L:)
    mfgrapmkaatataavgfsclcyhtlphlrypaelptlgfnykdgiqpvmsprqlelhys
    khhsayvdklntlgkgyegktieeiilattgineskvmfnqaaqhfnhsffwkclspggk
    pmpktlenaiakqfgsvddfmvsfqqagvnnfgsgwtwlcvdpqtkellidstsnagcpl
    tsglrpiftadvwehayykdfenrradylkelwqivdwefvchmyeratk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4f2nL (L:)
    cyhtlphlrypaelptlgfnykdgiqpvmsprqlelhyskhhsayvdklntlgkgyegkt
    ieeiilattgineskvmfnqaaqhfnhsffwkclspggkpmpktlenaiakqfgsvddfm
    vsfqqagvnnfgsgwtwlcvdpqtkellidstsnagcpltsglrpiftadvwehayykdf
    enrradylkelwqivdwefvchmyeratk