PDB entry 4f26

View 4f26 on RCSB PDB site
Description: Crystal structure of the second RRM domain of human PABPC1 a pH 9.0
Class: translation
Keywords: RRM fold, translation initiation, RNA-binding, eIF4G-binding, sytoplasm, TRANSLATION
Deposited on 2012-05-07, released 2012-08-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-01-02, with a file datestamp of 2012-12-28.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.219
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: polyadenylate-binding protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PABPC1, PAB1, PABP1, PABPC2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4f26a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4f26A (A:)
    gplgsgnifiknldksidnkalydtfsafgnilsckvvcdengskgygfvhfetqeaaer
    aiekmngmllndrkvfvgrfksrkereaelgarakeftnvyiknfgpgstraaas
    

    Sequence, based on observed residues (ATOM records): (download)
    >4f26A (A:)
    gnifiknldksidnkalydtfsafgnilsckvvcdengskgygfvhfetqeaaeraiekm
    ngmllndrkvfvgrfks