PDB entry 4f1r

View 4f1r on RCSB PDB site
Description: Structure analysis of the global metabolic regulator Crc from Pseudomonas aeruginos
Class: transcription regulator
Keywords: Catabolite Repression Control, post-transcription regulator, TRANSCRIPTION REGULATOR
Deposited on 2012-05-07, released 2013-02-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-02-06, with a file datestamp of 2013-02-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.204
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Catabolite repression control protein
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: crc
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4f1ra_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4f1rA (A:)
    mgsshhhhhhssgenlyfegshmasmtggqqmgrmriisvnvngiqaaaergllswlqaq
    nadviclqdtrasafdlddpsfqldgyflyacdaelpeqggvalysrlqpkavisglgfe
    tadrygrylqadfdkvsiatlllpsgqsgdeslnqkfkfmddfthylskqrrkrreyiyc
    gslyvahqkmdvknwrecqqmpgflaperawldevfgnlgyadalrevsregdqfswwpd
    seqaemlnlgwrfdyqvltpglrrfvrnaklprqprfsqhaplivdydwqlsi
    

    Sequence, based on observed residues (ATOM records): (download)
    >4f1rA (A:)
    mriisvnvngiqaaaergllswlqaqnadviclqdtrasafdlddpsfqldgyflyacda
    elpeqggvalysrlqpkavisglgfetadrygrylqadfdkvsiatlllpsgqsgdesln
    qkfkfmddfthylskqrrkrreyiycgslyvahqkmdvknwrecqqmpgflaperawlde
    vfgnlgyadalrevsregdqfswwpdseqaemlnlgwrfdyqvltpglrrfvrnaklprq
    prfsqhaplivdydwqlsi