PDB entry 4f0u

View 4f0u on RCSB PDB site
Description: X-Ray Crystal Structure of Allophycocyanin from Synechococcus elongatus PCC 7942
Class: photosynthesis
Keywords: Component of the phycobilisome, photosynthetic antenna complex, PHOTOSYNTHESIS
Deposited on 2012-05-05, released 2013-03-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-03-06, with a file datestamp of 2013-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.235
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: allophycocyanin alpha chain
    Species: SYNECHOCOCCUS ELONGATUS [TaxId:1140]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4f0ua_
  • Chain 'B':
    Compound: Allophycocyanin, beta subunit
    Species: SYNECHOCOCCUS ELONGATUS [TaxId:1140]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4f0ub_
  • Chain 'C':
    Compound: allophycocyanin alpha chain
    Species: SYNECHOCOCCUS ELONGATUS [TaxId:1140]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4f0uc_
  • Chain 'D':
    Compound: Allophycocyanin, beta subunit
    Species: SYNECHOCOCCUS ELONGATUS [TaxId:1140]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4f0ud_
  • Chain 'E':
    Compound: allophycocyanin alpha chain
    Species: SYNECHOCOCCUS ELONGATUS [TaxId:1140]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4f0ue_
  • Chain 'F':
    Compound: Allophycocyanin, beta subunit
    Species: SYNECHOCOCCUS ELONGATUS [TaxId:1140]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4f0uf_
  • Heterogens: CYC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4f0uA (A:)
    sivsksivnadaearylspgeleriktfvvggdrrlriaqtiaesrerivkqagnqlfqk
    rpdvvspggnaygedmtatclrdldyylrlvtygvvsgditpieeigivgvremykslgt
    pieavaegvrelksaatalltgedadeagayfdyvigals
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4f0uB (B:)
    mqdaitavinasdvqgkyldssaldrlksyfqsgelrvraaatisansalivkeavaksl
    lysditrpggnmyttrryaacirdleyylryatyamlagdtsildervlnglketynslg
    vpigatvqaiqaikevtaslvgpdagremgvyldyissgls
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4f0uC (C:)
    sivsksivnadaearylspgeleriktfvvggdrrlriaqtiaesrerivkqagnqlfqk
    rpdvvspggnaygedmtatclrdldyylrlvtygvvsgditpieeigivgvremykslgt
    pieavaegvrelksaatalltgedadeagayfdyvigals
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4f0uD (D:)
    mqdaitavinasdvqgkyldssaldrlksyfqsgelrvraaatisansalivkeavaksl
    lysditrpggnmyttrryaacirdleyylryatyamlagdtsildervlnglketynslg
    vpigatvqaiqaikevtaslvgpdagremgvyldyissgls
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4f0uE (E:)
    sivsksivnadaearylspgeleriktfvvggdrrlriaqtiaesrerivkqagnqlfqk
    rpdvvspggnaygedmtatclrdldyylrlvtygvvsgditpieeigivgvremykslgt
    pieavaegvrelksaatalltgedadeagayfdyvigals
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4f0uF (F:)
    mqdaitavinasdvqgkyldssaldrlksyfqsgelrvraaatisansalivkeavaksl
    lysditrpggnmyttrryaacirdleyylryatyamlagdtsildervlnglketynslg
    vpigatvqaiqaikevtaslvgpdagremgvyldyissgls