PDB entry 4ez3

View 4ez3 on RCSB PDB site
Description: CDK2 in complex with NSC 134199
Class: transferase/transferase inhibitor
Keywords: protein kinase, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2012-05-02, released 2012-08-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-10-03, with a file datestamp of 2012-09-28.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.215
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cyclin-dependent kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: CDK2, CDKN2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ez3a_
  • Heterogens: 0S0, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ez3A (A:)
    gplgspefmenfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstairei
    sllkelnhpnivklldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqll
    qglafchshrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrape
    illgckyystavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvts
    mpdykpsfpkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkp
    vphlrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ez3A (A:)
    menfqkvekigegtygvvykarnkltgevvalkkirtegvpstaireisllkelnhpniv
    klldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqglafchshrvl
    hrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgckyystav
    diwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdykpsfpkwa
    rqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphlrl