PDB entry 4eyr

View 4eyr on RCSB PDB site
Description: Crystal structure of multidrug-resistant clinical isolate 769 HIV-1 protease in complex with ritonavir
Class: hydrolase/hydrolase inhibitor
Keywords: Protease, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2012-05-01, released 2013-01-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-02-27, with a file datestamp of 2013-02-22.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.193
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hiv-1 protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q000H7 (0-98)
      • varaint (24)
      • variant (34-35)
      • variant (45)
      • variant (24)
    Domains in SCOPe 2.07: d4eyra_
  • Chain 'B':
    Compound: hiv-1 protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q000H7 (0-98)
      • varaint (24)
      • variant (34-35)
      • variant (45)
      • variant (24)
    Domains in SCOPe 2.07: d4eyrb_
  • Heterogens: RIT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4eyrA (A:)
    pqitlwqrpivtikiggqlkeallntgaddtvleevnlpgrwkpkliggiggfvkvrqyd
    qvpieicghkvigtvlvgptptnvigrnlmtqigctlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4eyrB (B:)
    pqitlwqrpivtikiggqlkeallntgaddtvleevnlpgrwkpkliggiggfvkvrqyd
    qvpieicghkvigtvlvgptptnvigrnlmtqigctlnf