PDB entry 4ewj

View 4ewj on RCSB PDB site
Description: structure of the enloase from Streptococcus suis serotype 2
Class: lyase
Keywords: two-domain enzyme, glycolytic pathway involved enzyme, plasminogen binding, LYASE
Deposited on 2012-04-27, released 2012-10-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-10-24, with a file datestamp of 2012-10-19.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.141
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Enolase 2
    Species: Streptococcus suis [TaxId:1307]
    Gene: eno, eno2, enolase, SSUST3_1361
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4ewja1, d4ewja2
  • Chain 'B':
    Compound: Enolase 2
    Species: Streptococcus suis [TaxId:1307]
    Gene: eno, eno2, enolase, SSUST3_1361
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4ewjb1, d4ewjb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ewjA (A:)
    msiitdvyarevldsrgnptlevevytesgafgrgmvpsgastgeheavelrdgdksryl
    glgtqkavdnvnnviadaiigfdvrdqqaidramialdgtpnkgklganailgvsiavar
    aaadylevplytylggfntkvlptpmmniinggshsdapiafqefmilpvgapsfkeglr
    wgaevfhalkkilkarglvtavgdeggfapkfegtedgvetiieaieaagyeagengimi
    gfdcassefydkerkvydytkfegegaavrtsaeqidyleelvnkypiitiedgmdendw
    dgwkalterlgkrvqlvgddffvtntdylargikegaansilikvnqigtltetfeaiem
    akeagytavvshrsgetedstiadiavatnagqiktgslsrtdriakynqllriedqlge
    vavykglnsfynlkklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ewjA (A:)
    msiitdvyarevldsrgnptlevevytesgafgrgmvpsggeheavelrdgdksrylglg
    tqkavdnvnnviadaiigfdvrdqqaidramialdgtpnkgklganailgvsiavaraaa
    dylevplytylggfntkvlptpmmniinggshsdapiafqefmilpvgapsfkeglrwga
    evfhalkkilkarglvtavgdeggfapkfegtedgvetiieaieaagyeagengimigfd
    cassefydrkvydytkfegegaavrtsaeqidyleelvnkypiitiedgmdendwdgwka
    lterlgkrvqlvgddffvtntdylargikegaansilikvnqigtltetfeaiemakeag
    ytavvshrsgetedstiadiavatnagqiktgslsrtdriakynqllriedqlgevavyk
    glnsfynl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4ewjB (B:)
    msiitdvyarevldsrgnptlevevytesgafgrgmvpsgastgeheavelrdgdksryl
    glgtqkavdnvnnviadaiigfdvrdqqaidramialdgtpnkgklganailgvsiavar
    aaadylevplytylggfntkvlptpmmniinggshsdapiafqefmilpvgapsfkeglr
    wgaevfhalkkilkarglvtavgdeggfapkfegtedgvetiieaieaagyeagengimi
    gfdcassefydkerkvydytkfegegaavrtsaeqidyleelvnkypiitiedgmdendw
    dgwkalterlgkrvqlvgddffvtntdylargikegaansilikvnqigtltetfeaiem
    akeagytavvshrsgetedstiadiavatnagqiktgslsrtdriakynqllriedqlge
    vavykglnsfynlkklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ewjB (B:)
    msiitdvyarevldsrgnptlevevytesgafgrgmvpsggeheavelrdgdksrylglg
    tqkavdnvnnviadaiigfdvrdqqaidramialdgtpnkgklganailgvsiavaraaa
    dylevplytylggfntkvlptpmmniinggshsdapiafqefmilpvgapsfkeglrwga
    evfhalkkilkarglvtavgdeggfapkfegtedgvetiieaieaagyeagengimigfd
    cassefydrkvydytkfegegaavrtsaeqidyleelvnkypiitiedgmdendwdgwka
    lterlgkrvqlvgddffvtntdylargikegaansilikvnqigtltetfeaiemakeag
    ytavvshrsgetedstiadiavatnagqiktgslsrtdriakynqllriedqlgevavyk
    glnsfynl