PDB entry 4evn

View 4evn on RCSB PDB site
Description: Crystal Structure of Fab CR6261 (somatic heavy chain with germline-reverted light chain)
Class: immune system
Keywords: Antibody, immune system, influenza HA
Deposited on 2012-04-26, released 2012-08-29
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-10-31, with a file datestamp of 2012-10-26.
Experiment type: XRAY
Resolution: 2.85 Å
R-factor: 0.231
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4EVN (0-End)
  • Chain 'B':
    Compound: Fab Lambda Light Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4EVN
    Domains in SCOPe 2.04: d4evnb1, d4evnb2
  • Chain 'C':
    Compound: Fab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4EVN (0-End)
  • Chain 'D':
    Compound: Fab Lambda Light Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4EVN
    Domains in SCOPe 2.04: d4evnd1, d4evnd2
  • Chain 'E':
    Compound: Fab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4EVN (0-End)
  • Chain 'F':
    Compound: Fab Lambda Light Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4EVN
    Domains in SCOPe 2.04: d4evnf1, d4evnf2
  • Chain 'G':
    Compound: Fab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4EVN (0-End)
  • Chain 'H':
    Compound: Fab Lambda Light Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4EVN
    Domains in SCOPe 2.04: d4evnh1, d4evnh2
  • Chain 'I':
    Compound: Fab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4EVN (0-End)
  • Chain 'J':
    Compound: Fab Lambda Light Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4EVN
    Domains in SCOPe 2.04: d4evnj1, d4evnj2
  • Chain 'K':
    Compound: Fab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4EVN (0-End)
  • Chain 'L':
    Compound: Fab Lambda Light Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4EVN
    Domains in SCOPe 2.04: d4evnl1, d4evnl2
  • Chain 'M':
    Compound: Fab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4EVN (0-End)
  • Chain 'N':
    Compound: Fab Lambda Light Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4EVN
    Domains in SCOPe 2.04: d4evnn1, d4evnn2
  • Chain 'O':
    Compound: Fab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4EVN (0-End)
  • Chain 'P':
    Compound: Fab Lambda Light Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4EVN
    Domains in SCOPe 2.04: d4evnp1, d4evnp2

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4evnB (B:)
    qsvltqppsvsaapgqkvtiscsgsssnignnyvswyqqlpgtapklliydnnkrpsgip
    drfsgsksgtsatlgitglqtgdeadyycgtwdsslsayvvfgggtkltvlgqpkanptv
    tlfppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskqsnnkyaas
    sylsltpeqwkshrsyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4evnB (B:)
    vltqppsvsaapgqkvtiscsgsssnignnyvswyqqlpgtapklliydnnkrpsgipdr
    fsgsksgtsatlgitglqtgdeadyycgtwdsslsayvvfgggtkltvlgqpkanptvtl
    fppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskqsnnkyaassy
    lsltpeqwkshrsyscqvthegstvektvapte
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4evnD (D:)
    qsvltqppsvsaapgqkvtiscsgsssnignnyvswyqqlpgtapklliydnnkrpsgip
    drfsgsksgtsatlgitglqtgdeadyycgtwdsslsayvvfgggtkltvlgqpkanptv
    tlfppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskqsnnkyaas
    sylsltpeqwkshrsyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4evnD (D:)
    vltqppsvsaapgqkvtiscsgsssnignnyvswyqqlpgtapklliydnnkrpsgipdr
    fsgsksgtsatlgitglqtgdeadyycgtwdsslsayvvfgggtkltvlgqpkanptvtl
    fppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskqsnnkyaassy
    lsltpeqwkshrsyscqvthegstvektvapte
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4evnF (F:)
    qsvltqppsvsaapgqkvtiscsgsssnignnyvswyqqlpgtapklliydnnkrpsgip
    drfsgsksgtsatlgitglqtgdeadyycgtwdsslsayvvfgggtkltvlgqpkanptv
    tlfppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskqsnnkyaas
    sylsltpeqwkshrsyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4evnF (F:)
    vltqppsvsaapgqkvtiscsgsssnignnyvswyqqlpgtapklliydnnkrpsgipdr
    fsgsksgtsatlgitglqtgdeadyycgtwdsslsayvvfgggtkltvlgqpkanptvtl
    fppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskqsnnkyaassy
    lsltpeqwkshrsyscqvthegstvektvapte
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4evnH (H:)
    qsvltqppsvsaapgqkvtiscsgsssnignnyvswyqqlpgtapklliydnnkrpsgip
    drfsgsksgtsatlgitglqtgdeadyycgtwdsslsayvvfgggtkltvlgqpkanptv
    tlfppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskqsnnkyaas
    sylsltpeqwkshrsyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4evnH (H:)
    vltqppsvsaapgqkvtiscsgsssnignnyvswyqqlpgtapklliydnnkrpsgipdr
    fsgsksgtsatlgitglqtgdeadyycgtwdsslsayvvfgggtkltvlgqpkanptvtl
    fppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskqsnnkyaassy
    lsltpeqwkshrsyscqvthegstvektvapte
    

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >4evnJ (J:)
    qsvltqppsvsaapgqkvtiscsgsssnignnyvswyqqlpgtapklliydnnkrpsgip
    drfsgsksgtsatlgitglqtgdeadyycgtwdsslsayvvfgggtkltvlgqpkanptv
    tlfppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskqsnnkyaas
    sylsltpeqwkshrsyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4evnJ (J:)
    vltqppsvsaapgqkvtiscsgsssnignnyvswyqqlpgtapklliydnnkrpsgipdr
    fsgsksgtsatlgitglqtgdeadyycgtwdsslsayvvfgggtkltvlgqpkanptvtl
    fppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskqsnnkyaassy
    lsltpeqwkshrsyscqvthegstvektvapte
    

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4evnL (L:)
    qsvltqppsvsaapgqkvtiscsgsssnignnyvswyqqlpgtapklliydnnkrpsgip
    drfsgsksgtsatlgitglqtgdeadyycgtwdsslsayvvfgggtkltvlgqpkanptv
    tlfppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskqsnnkyaas
    sylsltpeqwkshrsyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4evnL (L:)
    vltqppsvsaapgqkvtiscsgsssnignnyvswyqqlpgtapklliydnnkrpsgipdr
    fsgsksgtsatlgitglqtgdeadyycgtwdsslsayvvfgggtkltvlgqpkanptvtl
    fppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskqsnnkyaassy
    lsltpeqwkshrsyscqvthegstvektvapte
    

  • Chain 'M':
    No sequence available.

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >4evnN (N:)
    qsvltqppsvsaapgqkvtiscsgsssnignnyvswyqqlpgtapklliydnnkrpsgip
    drfsgsksgtsatlgitglqtgdeadyycgtwdsslsayvvfgggtkltvlgqpkanptv
    tlfppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskqsnnkyaas
    sylsltpeqwkshrsyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4evnN (N:)
    vltqppsvsaapgqkvtiscsgsssnignnyvswyqqlpgtapklliydnnkrpsgipdr
    fsgsksgtsatlgitglqtgdeadyycgtwdsslsayvvfgggtkltvlgqpkanptvtl
    fppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskqsnnkyaassy
    lsltpeqwkshrsyscqvthegstvektvapte
    

  • Chain 'O':
    No sequence available.

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >4evnP (P:)
    qsvltqppsvsaapgqkvtiscsgsssnignnyvswyqqlpgtapklliydnnkrpsgip
    drfsgsksgtsatlgitglqtgdeadyycgtwdsslsayvvfgggtkltvlgqpkanptv
    tlfppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskqsnnkyaas
    sylsltpeqwkshrsyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4evnP (P:)
    vltqppsvsaapgqkvtiscsgsssnignnyvswyqqlpgtapklliydnnkrpsgipdr
    fsgsksgtsatlgitglqtgdeadyycgtwdsslsayvvfgggtkltvlgqpkanptvtl
    fppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskqsnnkyaassy
    lsltpeqwkshrsyscqvthegstvektvapte