PDB entry 4ev3

View 4ev3 on RCSB PDB site
Description: Structure of Recombinant Cytochrome ba3 Oxidase mutant Y133W from Thermus thermophilus
Class: oxidoreductase
Keywords: Proton Pump, OXIDOREDUCTASE
Deposited on 2012-04-25, released 2012-05-09
The last revision prior to the SCOPe 2.02 freeze date was dated 2012-05-30, with a file datestamp of 2012-05-25.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.176
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome c oxidase subunit 1
    Species: Thermus thermophilus [TaxId:300852]
    Gene: cbaA, TTHA1135
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5SJ79 (Start-567)
      • engineered mutation (138)
  • Chain 'B':
    Compound: Cytochrome c oxidase subunit 2
    Species: Thermus thermophilus [TaxId:300852]
    Gene: cbaB, ctaC, TTHA1134
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Cytochrome c oxidase polypeptide 2A
    Species: Thermus thermophilus [TaxId:300852]
    Gene: cbaD, TTHA1133
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d4ev3c_
  • Heterogens: CU, HEM, HAS, PEO, OLC, CUA, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4ev3C (C:)
    meekpkgalavilvltltilvfwlgvyavffarg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ev3C (C:)
    kpkgalavilvltltilvfwlgvyavffarg