PDB entry 4eus

View 4eus on RCSB PDB site
Description: Crystal structure of the CFTR inhibitory factor Cif bound to 1,2-hexanediol
Class: hydrolase
Keywords: Alpha Beta Hydrolase, Epoxide Hydrolase, secreted, HYDROLASE
Deposited on 2012-04-25, released 2013-08-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-08-07, with a file datestamp of 2013-08-02.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.17
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative hydrolase
    Species: Pseudomonas aeruginosa [TaxId:208963]
    Gene: PA14_26090
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4eusa_
  • Chain 'B':
    Compound: Putative hydrolase
    Species: Pseudomonas aeruginosa [TaxId:208963]
    Gene: PA14_26090
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4eusb_
  • Chain 'C':
    Compound: Putative hydrolase
    Species: Pseudomonas aeruginosa [TaxId:208963]
    Gene: PA14_26090
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4eusc_
  • Chain 'D':
    Compound: Putative hydrolase
    Species: Pseudomonas aeruginosa [TaxId:208963]
    Gene: PA14_26090
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4eusd_
  • Heterogens: 0RE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4eusA (A:)
    aeefpvpngfesayrevdgvklhyvkggqgplvmlvhgfgqtwyewhqlmpelakrftvi
    apdlpglgqseppktgysgeqvavylhklarqfspdrpfdlvahdigiwntypmvvknqa
    diarlvymeapipdariyrfpaftaqgeslvwhfsffaaddrlaetliagkerfflehfi
    kshasntevfserlldlyarsyakphslnasfeyyralnesvrqnaelaktrlqmptmtl
    aggghggmgtfqleqmkayaedveghvlpgcghwlpeecaapmnrlvidflsrgrhhhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >4eusA (A:)
    aeefpvpngfesayrevdgvklhyvkggqgplvmlvhgfgqtwyewhqlmpelakrftvi
    apdlpglgqseppktgysgeqvavylhklarqfspdrpfdlvahdigiwntypmvvknqa
    diarlvymeapipdariyrfpaftaqgeslvwhfsffaaddrlaetliagkerfflehfi
    kshasntevfserlldlyarsyakphslnasfeyyralnesvrqnaelaktrlqmptmtl
    aggghggmgtfqleqmkayaedveghvlpgcghwlpeecaapmnrlvidflsr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4eusB (B:)
    aeefpvpngfesayrevdgvklhyvkggqgplvmlvhgfgqtwyewhqlmpelakrftvi
    apdlpglgqseppktgysgeqvavylhklarqfspdrpfdlvahdigiwntypmvvknqa
    diarlvymeapipdariyrfpaftaqgeslvwhfsffaaddrlaetliagkerfflehfi
    kshasntevfserlldlyarsyakphslnasfeyyralnesvrqnaelaktrlqmptmtl
    aggghggmgtfqleqmkayaedveghvlpgcghwlpeecaapmnrlvidflsrgrhhhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >4eusB (B:)
    aeefpvpngfesayrevdgvklhyvkggqgplvmlvhgfgqtwyewhqlmpelakrftvi
    apdlpglgqseppktgysgeqvavylhklarqfspdrpfdlvahdigiwntypmvvknqa
    diarlvymeapipdariyrfpaftaqgeslvwhfsffaaddrlaetliagkerfflehfi
    kshasntevfserlldlyarsyakphslnasfeyyralnesvrqnaelaktrlqmptmtl
    aggghggmgtfqleqmkayaedveghvlpgcghwlpeecaapmnrlvidflsr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4eusC (C:)
    aeefpvpngfesayrevdgvklhyvkggqgplvmlvhgfgqtwyewhqlmpelakrftvi
    apdlpglgqseppktgysgeqvavylhklarqfspdrpfdlvahdigiwntypmvvknqa
    diarlvymeapipdariyrfpaftaqgeslvwhfsffaaddrlaetliagkerfflehfi
    kshasntevfserlldlyarsyakphslnasfeyyralnesvrqnaelaktrlqmptmtl
    aggghggmgtfqleqmkayaedveghvlpgcghwlpeecaapmnrlvidflsrgrhhhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >4eusC (C:)
    aeefpvpngfesayrevdgvklhyvkggqgplvmlvhgfgqtwyewhqlmpelakrftvi
    apdlpglgqseppktgysgeqvavylhklarqfspdrpfdlvahdigiwntypmvvknqa
    diarlvymeapipdariyrfpaftaqgeslvwhfsffaaddrlaetliagkerfflehfi
    kshasntevfserlldlyarsyakphslnasfeyyralnesvrqnaelaktrlqmptmtl
    aggghggmgtfqleqmkayaedveghvlpgcghwlpeecaapmnrlvidflsr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4eusD (D:)
    aeefpvpngfesayrevdgvklhyvkggqgplvmlvhgfgqtwyewhqlmpelakrftvi
    apdlpglgqseppktgysgeqvavylhklarqfspdrpfdlvahdigiwntypmvvknqa
    diarlvymeapipdariyrfpaftaqgeslvwhfsffaaddrlaetliagkerfflehfi
    kshasntevfserlldlyarsyakphslnasfeyyralnesvrqnaelaktrlqmptmtl
    aggghggmgtfqleqmkayaedveghvlpgcghwlpeecaapmnrlvidflsrgrhhhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >4eusD (D:)
    aeefpvpngfesayrevdgvklhyvkggqgplvmlvhgfgqtwyewhqlmpelakrftvi
    apdlpglgqseppktgysgeqvavylhklarqfspdrpfdlvahdigiwntypmvvknqa
    diarlvymeapipdariyrfpaftaqgeslvwhfsffaaddrlaetliagkerfflehfi
    kshasntevfserlldlyarsyakphslnasfeyyralnesvrqnaelaktrlqmptmtl
    aggghggmgtfqleqmkayaedveghvlpgcghwlpeecaapmnrlvidflsr