PDB entry 4eur

View 4eur on RCSB PDB site
Description: Crystal structure of the JKF6 TCR
Class: immune system
Keywords: decapeptide, MHC class I, MART-1 peptide, HLA-A2, cross-reactivity, melanoma, cancer, IMMUNE SYSTEM
Deposited on 2012-04-25, released 2013-05-01
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-05-01, with a file datestamp of 2013-04-26.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.209
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: JKF6 alpha chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4EUR
    Domains in SCOPe 2.04: d4eura1, d4eura2
  • Chain 'B':
    Compound: JKF6 beta chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4EUR (Start-243)
    Domains in SCOPe 2.04: d4eurb1, d4eurb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4eurA (A:)
    mqkeveqnsgplsvpegaiaslnctysdrgsqsffwyrqysgkspelimsiysngdkedg
    rftaqlnkasqyvsllirdaqpsdsatylcavsgggadgltfgkgtqvvvtpniqnpdpa
    vyqlrdsksadksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsnk
    sdfacanafnnsiipedtffpspess
    

    Sequence, based on observed residues (ATOM records): (download)
    >4eurA (A:)
    eveqnsgplsvpegaiaslnctysdrgsqsffwyrqysgkspelimsiysngdkedgrft
    aqlnkasqyvsllirdaqpsdsatylcavsgggadgltfgkgtqvvvtpniqnpdpavyq
    lrdsksadksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsnksdf
    acanafnnsiipedtffpspe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4eurB (B:)
    mdvkvtqssrylvkrtgekvflecvqdmdhenmfwyrqdpglglrliyfsydvkmkekgd
    ipegysvsrekkerfslilasastdqtsmylcassflgtgveqyfgpgtrltvvedlnkv
    fppevalfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplkeq
    palndsryalssrlrvsatfwqdprnhfrcqvqfyglseadewtqdrakpvtqivsaeaw
    grad
    

    Sequence, based on observed residues (ATOM records): (download)
    >4eurB (B:)
    kvtqssrylvkrtgekvflecvqdmdhenmfwyrqdpglglrliyfsydvkmkekgdipe
    gysvsrekkerfslilasastdqtsmylcassflgtgveqyfgpgtrltvvedlnkvfpp
    evalfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplkeqpal
    ndsryalssrlrvsatfwqdprnhfrcqvqfyglseadewtqdrakpvtqivsaeawgra
    d