PDB entry 4euc

View 4euc on RCSB PDB site
Description: Succinyl-CoA:acetate CoA-transferase (AarCH6-E294A) in complex with dethiaacetyl-CoA
Class: transferase
Keywords: transferase
Deposited on 2012-04-25, released 2012-10-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 2.64 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Succinyl-CoA:acetate coenzyme A transferase
    Species: Acetobacter aceti [TaxId:435]
    Gene: aarC
    Database cross-references and differences (RAF-indexed):
    • Uniprot B3EY95 (Start-504)
      • engineered mutation (293)
    Domains in SCOPe 2.07: d4euca1, d4euca2
  • Chain 'B':
    Compound: Succinyl-CoA:acetate coenzyme A transferase
    Species: Acetobacter aceti [TaxId:435]
    Gene: aarC
    Database cross-references and differences (RAF-indexed):
    • Uniprot B3EY95 (Start-504)
      • engineered mutation (293)
    Domains in SCOPe 2.07: d4eucb1, d4eucb2
  • Heterogens: 0RQ, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4eucA (A:)
    mterirnvalrskvcpaetaselikhgdvvgtsgftgagypkevpkalaqrmeaahdrge
    kyqislitgastgpqldgelakangvyfrspfntdatmrnrinageteyfdnhlgqvagr
    avqgnygkfnialveataitedggivptssvgnsqtflnlaekviievnewqnpmlegih
    diwdgnvsgvptrdivpivradqrvggpvlrvnpdkiaaivrtndrdrnapfaapdetak
    aiagylldffghevkqnrlppsllplqsgvgnvanavleglkegpfenlvgysaviqdgm
    lamldsgrmriasassfslspeaaeeinnrmdffrskiilrqqdvsnspgiirrlgciam
    ngmieadiygnvnstrvmgskmmngiggsgdfarssylsiflspstakggkisaivpmaa
    hvdhimqdaqifvteqgladlrglspvqrareiiskcahpdyrpmlqdyfdralknsfgk
    htphlltealswhqrfidtgtmlpsslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4eucA (A:)
    terirnvalrskvcpaetaselikhgdvvgtsgftgagypkevpkalaqrmeaahdrgek
    yqislitgastgpqldgelakangvyfrspfntdatmrnrinageteyfdnhlgqvagra
    vqgnygkfnialveataitedggivptssvgnsqtflnlaekviievnewqnpmlegihd
    iwdgnvsgvptrdivpivradqrvggpvlrvnpdkiaaivrtndrdrnapfaapdetaka
    iagylldffghevkqnrlppsllplqsgvgnvanavleglkegpfenlvgysaviqdgml
    amldsgrmriasassfslspeaaeeinnrmdffrskiilrqqdvsnspgiirrlgciamn
    gmieadiygnvnstrvmgskmmngiggsgdfarssylsiflspstakggkisaivpmaah
    vdhimqdaqifvteqgladlrglspvqrareiiskcahpdyrpmlqdyfdralknsfgkh
    tphlltealswhqrfidtgtmlps
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4eucB (B:)
    mterirnvalrskvcpaetaselikhgdvvgtsgftgagypkevpkalaqrmeaahdrge
    kyqislitgastgpqldgelakangvyfrspfntdatmrnrinageteyfdnhlgqvagr
    avqgnygkfnialveataitedggivptssvgnsqtflnlaekviievnewqnpmlegih
    diwdgnvsgvptrdivpivradqrvggpvlrvnpdkiaaivrtndrdrnapfaapdetak
    aiagylldffghevkqnrlppsllplqsgvgnvanavleglkegpfenlvgysaviqdgm
    lamldsgrmriasassfslspeaaeeinnrmdffrskiilrqqdvsnspgiirrlgciam
    ngmieadiygnvnstrvmgskmmngiggsgdfarssylsiflspstakggkisaivpmaa
    hvdhimqdaqifvteqgladlrglspvqrareiiskcahpdyrpmlqdyfdralknsfgk
    htphlltealswhqrfidtgtmlpsslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4eucB (B:)
    terirnvalrskvcpaetaselikhgdvvgtsgftgagypkevpkalaqrmeaahdrgek
    yqislitgastgpqldgelakangvyfrspfntdatmrnrinageteyfdnhlgqvagra
    vqgnygkfnialveataitedggivptssvgnsqtflnlaekviievnewqnpmlegihd
    iwdgnvsgvptrdivpivradqrvggpvlrvnpdkiaaivrtndrdrnapfaapdetaka
    iagylldffghevkqnrlppsllplqsgvgnvanavleglkegpfenlvgysaviqdgml
    amldsgrmriasassfslspeaaeeinnrmdffrskiilrqqdvsnspgiirrlgciamn
    gmieadiygnvnstrvmgskmmngiggsgdfarssylsiflspstakggkisaivpmaah
    vdhimqdaqifvteqgladlrglspvqrareiiskcahpdyrpmlqdyfdralknsfgkh
    tphlltealswhqrfidtgtmlps