PDB entry 4eu4

View 4eu4 on RCSB PDB site
Description: Succinyl-CoA: acetate CoA-transferase (AarCH6) in complex with CoA (hexagonal lattice)
Class: transferase
Keywords: transferase
Deposited on 2012-04-25, released 2012-10-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Succinyl-CoA:acetate coenzyme A transferase
    Species: Acetobacter aceti [TaxId:435]
    Gene: aarC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4eu4a1, d4eu4a2
  • Chain 'B':
    Compound: Succinyl-CoA:acetate coenzyme A transferase
    Species: Acetobacter aceti [TaxId:435]
    Gene: aarC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4eu4b1, d4eu4b2
  • Heterogens: COA, SO4, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4eu4A (A:)
    mterirnvalrskvcpaetaselikhgdvvgtsgftgagypkevpkalaqrmeaahdrge
    kyqislitgastgpqldgelakangvyfrspfntdatmrnrinageteyfdnhlgqvagr
    avqgnygkfnialveataitedggivptssvgnsqtflnlaekviievnewqnpmlegih
    diwdgnvsgvptrdivpivradqrvggpvlrvnpdkiaaivrtndrdrnapfaapdetak
    aiagylldffghevkqnrlppsllplqsgvgnvanavleglkegpfenlvgyseviqdgm
    lamldsgrmriasassfslspeaaeeinnrmdffrskiilrqqdvsnspgiirrlgciam
    ngmieadiygnvnstrvmgskmmngiggsgdfarssylsiflspstakggkisaivpmaa
    hvdhimqdaqifvteqgladlrglspvqrareiiskcahpdyrpmlqdyfdralknsfgk
    htphlltealswhqrfidtgtmlpsslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4eu4A (A:)
    terirnvalrskvcpaetaselikhgdvvgtsgftgagypkevpkalaqrmeaahdrgek
    yqislitgastgpqldgelakangvyfrspfntdatmrnrinageteyfdnhlgqvagra
    vqgnygkfnialveataitedggivptssvgnsqtflnlaekviievnewqnpmlegihd
    iwdgnvsgvptrdivpivradqrvggpvlrvnpdkiaaivrtndrdrnapfaapdetaka
    iagylldffghevkqnrlppsllplqsgvgnvanavleglkegpfenlvgyseviqdgml
    amldsgrmriasassfslspeaaeeinnrmdffrskiilrqqdvsnspgiirrlgciamn
    gmieadiygnvnstrvmgskmmngiggsgdfarssylsiflspstakggkisaivpmaah
    vdhimqdaqifvteqgladlrglspvqrareiiskcahpdyrpmlqdyfdralknsfgkh
    tphlltealswhqrfidtgtmlps
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4eu4B (B:)
    mterirnvalrskvcpaetaselikhgdvvgtsgftgagypkevpkalaqrmeaahdrge
    kyqislitgastgpqldgelakangvyfrspfntdatmrnrinageteyfdnhlgqvagr
    avqgnygkfnialveataitedggivptssvgnsqtflnlaekviievnewqnpmlegih
    diwdgnvsgvptrdivpivradqrvggpvlrvnpdkiaaivrtndrdrnapfaapdetak
    aiagylldffghevkqnrlppsllplqsgvgnvanavleglkegpfenlvgyseviqdgm
    lamldsgrmriasassfslspeaaeeinnrmdffrskiilrqqdvsnspgiirrlgciam
    ngmieadiygnvnstrvmgskmmngiggsgdfarssylsiflspstakggkisaivpmaa
    hvdhimqdaqifvteqgladlrglspvqrareiiskcahpdyrpmlqdyfdralknsfgk
    htphlltealswhqrfidtgtmlpsslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4eu4B (B:)
    terirnvalrskvcpaetaselikhgdvvgtsgftgagypkevpkalaqrmeaahdrgek
    yqislitgastgpqldgelakangvyfrspfntdatmrnrinageteyfdnhlgqvagra
    vqgnygkfnialveataitedggivptssvgnsqtflnlaekviievnewqnpmlegihd
    iwdgnvsgvptrdivpivradqrvggpvlrvnpdkiaaivrtndrdrnapfaapdetaka
    iagylldffghevkqnrlppsllplqsgvgnvanavleglkegpfenlvgyseviqdgml
    amldsgrmriasassfslspeaaeeinnrmdffrskiilrqqdvsnspgiirrlgciamn
    gmieadiygnvnstrvmgskmmngiggsgdfarssylsiflspstakggkisaivpmaah
    vdhimqdaqifvteqgladlrglspvqrareiiskcahpdyrpmlqdyfdralknsfgkh
    tphlltealswhqrfidtgtmlps