PDB entry 4ets

View 4ets on RCSB PDB site
Description: Crystal structure of Campylobacter jejuni ferric uptake regulator
Class: metal binding protein
Keywords: metal binding protein, transcription factor
Deposited on 2012-04-24, released 2012-06-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-07-25, with a file datestamp of 2012-07-20.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.237
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ferric uptake regulation protein
    Species: Campylobacter jejuni subsp. jejuni [TaxId:32022]
    Gene: fur, Cj0400
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4etsa_
  • Chain 'B':
    Compound: ferric uptake regulation protein
    Species: Campylobacter jejuni subsp. jejuni [TaxId:32022]
    Gene: fur, Cj0400
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0C631
      • expression tag (0-4)
    Domains in SCOPe 2.07: d4etsb1, d4etsb2
  • Heterogens: ZN, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4etsA (A:)
    atyammlienveydvllerfkkilrqgglkytkqrevllktlyhsdthytpeslymeikq
    aepdlnvgiatvyrtlnlleeaemvtsisfgsagkkyelankphhdhmickncgkiiefe
    npiierqqaliakehgfkltghlmqlygvcgdcnnqkakvki
    

    Sequence, based on observed residues (ATOM records): (download)
    >4etsA (A:)
    enveydvllerfkkilrqgglkytkqrevllktlyhsdthytpeslymeikqaepdlnvg
    iatvyrtlnlleeaemvtsiskkyelankphhdhmickncgkiiefenpiierqqaliak
    ehgfkltghlmqlygvcgdcn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4etsB (B:)
    atyammlienveydvllerfkkilrqgglkytkqrevllktlyhsdthytpeslymeikq
    aepdlnvgiatvyrtlnlleeaemvtsisfgsagkkyelankphhdhmickncgkiiefe
    npiierqqaliakehgfkltghlmqlygvcgdcnnqkakvki
    

    Sequence, based on observed residues (ATOM records): (download)
    >4etsB (B:)
    atyamlienveydvllerfkytkqrevllktlyhsdthytpeslymeikqaepdlnvgia
    tvyrtlnlleeaemvtsisfgsagkkyelankphhdhmickncgkiiefenpiierqqal
    iakehgfkltghlmqlygvcgdcnnqkak