PDB entry 4etq

View 4etq on RCSB PDB site
Description: Vaccinia virus D8L IMV envelope protein in complex with Fab of murine IgG2a LA5
Class: immune system/viral protein
Keywords: variable domain, constant domain, IgG2a, IgG domain, CDR, hypervariable region, neutralizing antibody, beta sheet, carbonic anhydrase fold, loose knot, chondroitin-sulfate binding site, delta 262, IMMUNE SYSTEM-VIRAL PROTEIN complex
Deposited on 2012-04-24, released 2012-06-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-07-25, with a file datestamp of 2012-07-20.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.203
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: anti-vaccinia D8L antigen murine monoclonal IgG2a antibody LA5, heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene: IgG2a, IGHV1S127*01
    Database cross-references and differences (RAF-indexed):
    • PDB 4ETQ (0-End)
  • Chain 'B':
    Compound: anti-vaccinia D8L antigen murine monoclonal IgG2a antibody LA5, light chain
    Species: Mus musculus [TaxId:10090]
    Gene: IgG2a, IGKV4-55*01 germ line
    Database cross-references and differences (RAF-indexed):
    • PDB 4ETQ (0-211)
    Domains in SCOPe 2.06: d4etqb1, d4etqb2
  • Chain 'C':
    Compound: IMV membrane protein
    Species: Vaccinia virus [TaxId:10245]
    Gene: D8L, VACAC2_124, VACCL3_124, VAC_DPP17_124
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4etqc_
  • Chain 'H':
    Compound: anti-vaccinia D8L antigen murine monoclonal IgG2a antibody LA5, heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene: IgG2a, IGHV1S127*01
    Database cross-references and differences (RAF-indexed):
    • PDB 4ETQ (0-End)
  • Chain 'L':
    Compound: anti-vaccinia D8L antigen murine monoclonal IgG2a antibody LA5, light chain
    Species: Mus musculus [TaxId:10090]
    Gene: IgG2a, IGKV4-55*01 germ line
    Database cross-references and differences (RAF-indexed):
    • PDB 4ETQ (0-211)
    Domains in SCOPe 2.06: d4etql1, d4etql2
  • Chain 'X':
    Compound: IMV membrane protein
    Species: Vaccinia virus [TaxId:10245]
    Gene: D8L, VACAC2_124, VACCL3_124, VAC_DPP17_124
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4etqx_
  • Heterogens: SCN, EDO, GOL, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4etqB (B:)
    qivltqspaimsafpgesvtmtcsasssvsymywyqqkpgssprlliydtsnlasgvpvr
    fsgsgsgtsysltinrleaedgatyycqqwtsypltfgagtklelkradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfnrne
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4etqC (C:)
    mpqqlspinietkkaisnarlkpldihyneskpttiqntgklvrinfkggyisggflpne
    yvlsslhiywgkeddygsnhlidvykysgeinlvhwnkkkyssyeeakkhddgliiisif
    lqvldhknvyfqkivnqldsirsantsapfdsvfyldnllpskldyftylgttinhsada
    vwiifptpinihsdqlskfrtllslsnhegkphyitenyrnpyklnddtevyysgeiira
    attsparenyfmrwlsdlretlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4etqC (C:)
    qqlspinietkkaisnarlkpldihyneskpttiqntgklvrinfkggyisggflpneyv
    lsslhiywgkeddygsnhlidvykysgeinlvhwnkkkyssyeeakkhddgliiisiflq
    vldhknvyfqkivnqldsirsantsapfdsvfyldnllpskldyftylgttinhsadavw
    iifptpinihsdqlskfrtllslyitenyrnpyklnddtevyysg
    

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4etqL (L:)
    qivltqspaimsafpgesvtmtcsasssvsymywyqqkpgssprlliydtsnlasgvpvr
    fsgsgsgtsysltinrleaedgatyycqqwtsypltfgagtklelkradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfnrne
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >4etqX (X:)
    mpqqlspinietkkaisnarlkpldihyneskpttiqntgklvrinfkggyisggflpne
    yvlsslhiywgkeddygsnhlidvykysgeinlvhwnkkkyssyeeakkhddgliiisif
    lqvldhknvyfqkivnqldsirsantsapfdsvfyldnllpskldyftylgttinhsada
    vwiifptpinihsdqlskfrtllslsnhegkphyitenyrnpyklnddtevyysgeiira
    attsparenyfmrwlsdlretlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4etqX (X:)
    pqqlspinietkkaisnarlkpldihyneskpttiqntgklvrinfkggyisggflpney
    vlsslhiywgkeddygsnhlidvykysgeinlvhwnkkkyssyeeakkhddgliiisifl
    qvldhknvyfqkivnqldsirsantsapfdsvfyldnllpskldyftylgttinhsadav
    wiifptpinihsdqlskfrtllslhyitenyrnpyklnddtevyysge