PDB entry 4eto

View 4eto on RCSB PDB site
Description: Structure of S100A4 in complex with non-muscle myosin-IIA peptide
Class: metal binding protein
Keywords: CALCIUM-BINDING PROTEIN, EF-hand, Structural Genomics, PSI-Biology, Protein Structure Initiative, New York Structural Genomics Research Consortium, NYSGRC, METAL BINDING PROTEIN
Deposited on 2012-04-24, released 2012-07-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-07-18, with a file datestamp of 2012-07-13.
Experiment type: XRAY
Resolution: 1.54 Å
R-factor: 0.211
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein S100-A4
    Species: Homo sapiens [TaxId:9606]
    Gene: CAPL, MTS1, S100A4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4etoa_
  • Chain 'B':
    Compound: Protein S100-A4
    Species: Homo sapiens [TaxId:9606]
    Gene: CAPL, MTS1, S100A4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4etob_
  • Chain 'P':
    Compound: myosin-9
    Species: Homo sapiens [TaxId:9606]
    Gene: MYH9
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4etoA (A:)
    macplekaldvmvstfhkysgkegdkfklnkselkelltrelpsflgkrtdeaafqklms
    nldsnrdnevdfqeycvflsciammcneffegf
    

    Sequence, based on observed residues (ATOM records): (download)
    >4etoA (A:)
    acplekaldvmvstfhkysgkegdkfklnkselkelltrelpsfltdeaafqklmsnlds
    nrdnevdfqeycvflsciammcneffeg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4etoB (B:)
    macplekaldvmvstfhkysgkegdkfklnkselkelltrelpsflgkrtdeaafqklms
    nldsnrdnevdfqeycvflsciammcneffegf
    

    Sequence, based on observed residues (ATOM records): (download)
    >4etoB (B:)
    acplekaldvmvstfhkysgkegdkfklnkselkelltrelpsflgkrtdeaafqklmsn
    ldsnrdnevdfqeycvflsciammcneffeg
    

  • Chain 'P':
    No sequence available.