PDB entry 4esl

View 4esl on RCSB PDB site
Description: Structure of Recombinant Cytochrome ba3 Oxidase mutant Y133W+T231F from Thermus thermophilus
Class: oxidoreductase
Keywords: Proton Pump, OXIDOREDUCTASE
Deposited on 2012-04-23, released 2012-05-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-01-16, with a file datestamp of 2013-01-11.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.179
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome c oxidase subunit 1
    Species: Thermus thermophilus [TaxId:300852]
    Gene: cbaA, TTHA1135
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5SJ79 (Start-568)
      • engineered mutation (139)
      • engineered mutation (237)
    Domains in SCOPe 2.07: d4esla_
  • Chain 'B':
    Compound: Cytochrome c oxidase subunit 2
    Species: Thermus thermophilus [TaxId:300852]
    Gene: cbaB, ctaC, TTHA1134
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4eslb1, d4eslb2
  • Chain 'C':
    Compound: Cytochrome c oxidase polypeptide 2A
    Species: Thermus thermophilus [TaxId:300852]
    Gene: cbaD, TTHA1133
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CU, HEM, HAS, OLC, CUA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4eslA (A:)
    mhhhhhhhavraseisrvyeaypekkatlyflvlgflalivgslfgpfqalnygnvdayp
    llkrllpfvqsyyqgltlhgvlnaivftqlfaqaimvylparelnmrpnmglmwlswwma
    figlvvaalpllaneatvlwtfypplkghwafylgasvfvlstwvsiyivldlwrrwkaa
    npgkvtplvtymavvfwlmwflaslglvleavlfllpwsfglvegvdplvartlfwwfgh
    pivyfwllpayaiiytilpkqaggklvsdpmarlafllflllstpvgfhhqfadpgidpt
    wkmihsvltlfvavpslmtaftvaaslefagrlrggrglfgwiralpwdnpafvapvlgl
    lgfipggaggivnasftldyvvhntawvpghfhlqvaslvtltamgslywllpnltgkpi
    sdaqrrlglavvwlwflgmmimavglhwagllnvprrayiaqvpdayphaavpmvfnvla
    givllvalllfiyglfsvllsrerkpelaeaplpfaevisgpedrrlvlamdrigfwfav
    aailvvlaygptlvqlfghlnpvpgwrlw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4eslA (A:)
    ypekkatlyflvlgflalivgslfgpfqalnygnvdaypllkrllpfvqsyyqgltlhgv
    lnaivftqlfaqaimvylparelnmrpnmglmwlswwmafiglvvaalpllaneatvlwt
    fypplkghwafylgasvfvlstwvsiyivldlwrrwkaanpgkvtplvtymavvfwlmwf
    laslglvleavlfllpwsfglvegvdplvartlfwwfghpivyfwllpayaiiytilpkq
    aggklvsdpmarlafllflllstpvgfhhqfadpgidptwkmihsvltlfvavpslmtaf
    tvaaslefagrlrggrglfgwiralpwdnpafvapvlgllgfipggaggivnasftldyv
    vhntawvpghfhlqvaslvtltamgslywllpnltgkpisdaqrrlglavvwlwflgmmi
    mavglhwagllnvprrayiaqvpdayphaavpmvfnvlagivllvalllfiyglfplpfa
    evidrrlvlamdrigfwfavaailvvlaygptlvqlfghlnpvpgwrlw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4eslB (B:)
    mvdehkahkailayekgwlafslamlfvfialiaytlathtagvipagklervdpttvrq
    egpwadpaqavvqtgpnqytvyvlafafgyqpnpievpqgaeivfkitspdvihgfhveg
    tninvevlpgevstvrytfkrpgeyriicnqycglghqnmfgtivvke
    

    Sequence, based on observed residues (ATOM records): (download)
    >4eslB (B:)
    dehkahkailayekgwlafslamlfvfialiaytlathtagvipagklervdpttvrqeg
    pwadpaqavvqtgpnqytvyvlafafgyqpnpievpqgaeivfkitspdvihgfhvegtn
    invevlpgevstvrytfkrpgeyriicnqycglghqnmfgtivvke
    

  • Chain 'C':
    No sequence available.