PDB entry 4esf

View 4esf on RCSB PDB site
Description: Crystal structure of PadR-like transcriptional regulator (BCE3449) from Bacillus cereus strain ATCC 10987
Class: transcription
Keywords: PadR family, transcriptional regulator, DNA binding protein, winged-HTH fold, TRANSCRIPTION
Deposited on 2012-04-23, released 2012-12-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-12-12, with a file datestamp of 2012-12-07.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.223
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PadR-like transcriptional regulator
    Species: Bacillus cereus [TaxId:222523]
    Gene: BCE_3449
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q734F6 (Start-104)
      • expression tag (105-106)
    Domains in SCOPe 2.06: d4esfa1, d4esfa2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4esfA (A:)
    menltemlkgslegcvleiisrretygyeitrhlndlgftevvegtvytilvrlekkklv
    niekkpsdmgpprkfyslneagrqelelfwkkwdfvsskinvlkssnsrwshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >4esfA (A:)
    nltemlkgslegcvleiisrretygyeitrhlndlgftevvegtvytilvrlekkklvni
    ekkpprkfyslneagrqelelfwkkwdfvsskinvlkssn