PDB entry 4esb

View 4esb on RCSB PDB site
Description: Crystal structure of PadR-like transcriptional regulator (BC4206) from Bacillus cereus strain ATCC 14579
Class: transcription
Keywords: PadR family, transcriptional regulator, DNA binding protein, winged-HTH fold, TRANSCRIPTION
Deposited on 2012-04-23, released 2012-12-05
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-12-26, with a file datestamp of 2012-12-21.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.202
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcriptional regulator, PadR family
    Species: Bacillus cereus [TaxId:226900]
    Gene: BC_4206
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4esba_
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4esbA (A:)
    mhsqmlkgvlegcilyiisqeevygyelstklnkhgftfvsegsiyplllrmqkeklieg
    tlkasslgpkrkyyhitdkgleqleefkqswgmvsttvnnllqgesrwshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >4esbA (A:)
    sqmlkgvlegcilyiisqeevygyelstklnkhgftfvsegsiyplllrmqkekliegtl
    kasslgpkrkyyhitdkgleqleefkqswgmvsttvnnllqge