PDB entry 4ers

View 4ers on RCSB PDB site
Description: A Molecular Basis for Negative Regulation of the Glucagon Receptor
Class: immune system
Keywords: Glucagon receptor, Class-B GPCR, Fab, Glycosylation, Extra-cellular, IMMUNE SYSTEM
Deposited on 2012-04-20, released 2012-08-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-12-05, with a file datestamp of 2012-11-30.
Experiment type: XRAY
Resolution: 2.64 Å
R-factor: 0.234
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glucagon receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: GCGR
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: Fab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4ERS (0-230)
  • Chain 'L':
    Compound: Fab light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4ERS (0-213)
    Domains in SCOPe 2.07: d4ersl1, d4ersl2
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4ersL (L:)
    diqmtqspsslsasvgdrvtitcrasqgirndlgwyqqkpgkapkrliyaasslesgvps
    rfsgsgsgteftltissvqpedfvtyyclqhnsnpltfgggtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec