PDB entry 4epv

View 4epv on RCSB PDB site
Description: Discovery of Small Molecules that Bind to K-Ras and Inhibit Sos-mediated Activation
Class: hydrolase
Keywords: small GTPase, Signaling transduction, Sos, Raf, Ral, PI3K, cytosol, binder, HYDROLASE, Inhibitor of Sos-mediated activation
Deposited on 2012-04-17, released 2012-05-23
The last revision prior to the SCOPe 2.02 freeze date was dated 2012-07-25, with a file datestamp of 2012-07-20.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: 0.165
AEROSPACI score: 0.73 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GTPase KRas
    Species: Homo sapiens [TaxId:9606]
    Gene: KRAS, KRAS2, RASK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01116 (1-169)
      • expression tag (0)
      • engineered mutation (118)
    Domains in SCOPe 2.02: d4epva_
  • Heterogens: GDP, MG, 0QX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4epvA (A:)
    gmteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildta
    gqeeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnksd
    lpsrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhkek