PDB entry 4epr

View 4epr on RCSB PDB site
Description: Discovery of Small Molecules that Bind to K-Ras and Inhibit Sos-Mediated Activation.
Class: hydrolase
Keywords: closed conformation, KRas, p21, GTP-binding protein, oncogene, HYDROLASE, Inhibitor of Sos-mediated activation, binder
Deposited on 2012-04-17, released 2012-05-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-07-25, with a file datestamp of 2012-07-20.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.203
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GTPase KRas
    Species: Homo sapiens [TaxId:9606]
    Gene: KRAS, KRAS2, RASK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01116 (1-End)
      • engineered mutation (12)
      • engineered mutation (118)
    Domains in SCOPe 2.06: d4epra_
  • Heterogens: GDP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4eprA (A:)
    gmteyklvvvgadgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildta
    gqeeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnksd
    lpsrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhkek
    

    Sequence, based on observed residues (ATOM records): (download)
    >4eprA (A:)
    mteyklvvvgadgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
    qeeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnksdl
    psrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkh