PDB entry 4eow

View 4eow on RCSB PDB site
Description: Crystal structure of a disease-associated anti-human GM-CSF autoantibody MB007
Class: immune system
Keywords: Immunsystem, alpha-helical stretch in CDR3-H, protein-docking, Immunoglobulin IgG1 (lambda), autoantibody causing PAP, GM-CSF, IMMUNE SYSTEM
Deposited on 2012-04-16, released 2012-08-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-06-28, with a file datestamp of 2017-06-23.
Experiment type: XRAY
Resolution: 1.97 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: MB007 human IgG1 Fab fragment heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4EOW (0-126)
    • Uniprot S6B291 (127-227)
  • Chain 'L':
    Compound: MB007 IgG1 Fab fragment light chain
    Species: Homo sapiens [TaxId:9606]
    Gene: IGLC2
    Database cross-references and differences (RAF-indexed):
    • PDB 4EOW (Start-110)
    • Uniprot P0DOY2 (111-End)
    Domains in SCOPe 2.07: d4eowl1, d4eowl2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4eowL (L:)
    qsvltqppsasgtpgqsvniscsgsssnignsyvywyqqlpgtapklliyrnnrrpsgvp
    drfsgsksdtsaslaisglrsedeadyycatwddslsgrlfgggtkltvlgqpkaapsvt
    lfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaass
    ylsltpeqwkshrsyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4eowL (L:)
    svltqppsasgtpgqsvniscsgsssnignsyvywyqqlpgtapklliyrnnrrpsgvpd
    rfsgsksdtsaslaisglrsedeadyycatwddslsgrlfgggtkltvlgqpkaapsvtl
    fppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassy
    lsltpeqwkshrsyscqvthegstvektvap