PDB entry 4eon

View 4eon on RCSB PDB site
Description: Thr 160 phosphorylated CDK2 H84S, Q85M, Q131E - human cyclin A3 complex with the inhibitor RO3306
Class: transferase/transferase inhibitor
Keywords: protein kinase, cell cycle, PHOSPHORYLATION, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2012-04-14, released 2013-02-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-02-06, with a file datestamp of 2013-02-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.22
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cyclin-dependent kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: CDK2, CDKN2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P24941 (2-299)
      • expression tag (0-1)
      • engineered mutation (85-86)
      • engineered mutation (132)
    Domains in SCOPe 2.07: d4eona1, d4eona2
  • Chain 'B':
    Compound: Cyclin-A2
    Species: Homo sapiens [TaxId:9606]
    Gene: CCNA2, CCN1, CCNA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4eonb1, d4eonb2
  • Chain 'C':
    Compound: cyclin-dependent kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: CDK2, CDKN2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P24941 (2-End)
      • expression tag (0-1)
      • engineered mutation (85-86)
      • engineered mutation (132)
    Domains in SCOPe 2.07: d4eonc1, d4eonc2
  • Chain 'D':
    Compound: Cyclin-A2
    Species: Homo sapiens [TaxId:9606]
    Gene: CCNA2, CCN1, CCNA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4eond1, d4eond2
  • Heterogens: 1RO, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4eonA (A:)
    gsmenfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllkel
    nhpnivklldvihtenklylvfeflsmdlkkfmdasaltgiplpliksylfqllqglafc
    hshrvlhrdlkpenllintegaikladfglarafgvpvrtythevvtlwyrapeillgck
    yystavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdykp
    sfpkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphlrl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4eonB (B:)
    vpdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhl
    avnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrm
    ehlvlkvltfdlaaptvnqfltqyflhqqpanckveslamflgelslidadpylkylpsv
    iagaafhlalytvtgqswpeslirktgytleslkpclmdlhqtylkapqhaqqsirekyk
    nskyhgvsllnppetlnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4eonB (B:)
    pdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhla
    vnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrme
    hlvlkvltfdlaaptvnqfltqyflhqqpanckveslamflgelslidadpylkylpsvi
    agaafhlalytvtgqswpeslirktgytleslkpclmdlhqtylkapqhaqqsirekykn
    skyhgvsllnppetlnl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4eonC (C:)
    gsmenfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllkel
    nhpnivklldvihtenklylvfeflsmdlkkfmdasaltgiplpliksylfqllqglafc
    hshrvlhrdlkpenllintegaikladfglarafgvpvrtythevvtlwyrapeillgck
    yystavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdykp
    sfpkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphlrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4eonC (C:)
    gsmenfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllkel
    nhpnivklldvihtenklylvfeflsmdlkkfmdasaltgiplpliksylfqllqglafc
    hshrvlhrdlkpenllintegaikladfglarafgvpvrtythevvtlwyrapeillgck
    yystavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdykp
    sfpkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphlr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4eonD (D:)
    vpdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhl
    avnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrm
    ehlvlkvltfdlaaptvnqfltqyflhqqpanckveslamflgelslidadpylkylpsv
    iagaafhlalytvtgqswpeslirktgytleslkpclmdlhqtylkapqhaqqsirekyk
    nskyhgvsllnppetlnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4eonD (D:)
    vpdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhl
    avnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrm
    ehlvlkvltfdlaaptvnqfltqyflhqqpanckveslamflgelslidadpylkylpsv
    iagaafhlalytvtgqswpeslirktgytleslkpclmdlhqtylkapqhaqqsirekyk
    nskyhgvsllnppetln