PDB entry 4en0

View 4en0 on RCSB PDB site
Description: Crystal structure of light
Class: cytokine
Keywords: STRUCTURAL GENOMICS, PSI-BIOLOGY, NEW YORK STRUCTURAL GENOMICS RESEARCH CONSORTIUM, NYSGRC, IMMUNITY, TNF SUPERFAMILY, HVEM, DCR3, N-GLYCOSYLATION, MEMBRANE, SECRETED PROTEIN, CYTOKINE, ATOMS-TO-ANIMALS: THE IMMUNE FUNCTION NETWORK, IFN, Jelly-roll Fold, Bind TNF receptor HVEM and LTbR, LTbR
Deposited on 2012-04-12, released 2012-05-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-12-31, with a file datestamp of 2014-12-26.
Experiment type: XRAY
Resolution: 2.59 Å
R-factor: 0.236
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tumor necrosis factor ligand superfamily member 14
    Species: Homo sapiens [TaxId:9606]
    Gene: HVEML, LIGHT, TNFSF14, UNQ391/PRO726
    Database cross-references and differences (RAF-indexed):
    • Uniprot O43557 (Start-166)
      • see remark 999 (140)
    Domains in SCOPe 2.06: d4en0a_
  • Chain 'B':
    Compound: Tumor necrosis factor ligand superfamily member 14
    Species: Homo sapiens [TaxId:9606]
    Gene: HVEML, LIGHT, TNFSF14, UNQ391/PRO726
    Database cross-references and differences (RAF-indexed):
    • Uniprot O43557 (Start-166)
      • see remark 999 (140)
    Domains in SCOPe 2.06: d4en0b_
  • Chain 'C':
    Compound: Tumor necrosis factor ligand superfamily member 14
    Species: Homo sapiens [TaxId:9606]
    Gene: HVEML, LIGHT, TNFSF14, UNQ391/PRO726
    Database cross-references and differences (RAF-indexed):
    • Uniprot O43557 (Start-166)
      • see remark 999 (140)
    Domains in SCOPe 2.06: d4en0c_
  • Heterogens: PO4, GOL, NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4en0A (A:)
    rshhhhhhgliqerrshevnpaahltganssltgsggpllwetqlglaflrglsyhdgal
    vvtkagyyyiyskvqlggvgcplglastithglykrtprypeelellvsqqspcgratss
    srvwwdssflggvvhleageevvvrvlderlvrlrdgtrsyfgafmv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4en0A (A:)
    npaahltganssltgsggpllwetqlglaflrglsyhdgalvvtkagyyyiyskvqlggv
    gcplglastithglykrtprypeelellvsqqspcgratrvwwdssflggvvhleageev
    vvrvlderlvrlrdgtrsyfgafmv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4en0B (B:)
    rshhhhhhgliqerrshevnpaahltganssltgsggpllwetqlglaflrglsyhdgal
    vvtkagyyyiyskvqlggvgcplglastithglykrtprypeelellvsqqspcgratss
    srvwwdssflggvvhleageevvvrvlderlvrlrdgtrsyfgafmv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4en0B (B:)
    vnpaahltgansssggpllwetqlglaflrglsyhdgalvvtkagyyyiyskvqlggvgc
    plstithglykrtprypeelellvsqqspcgratsssrvwwdssflggvvhleageevvv
    rvlderlvrlrdgtrsyfgafmv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4en0C (C:)
    rshhhhhhgliqerrshevnpaahltganssltgsggpllwetqlglaflrglsyhdgal
    vvtkagyyyiyskvqlggvgcplglastithglykrtprypeelellvsqqspcgratss
    srvwwdssflggvvhleageevvvrvlderlvrlrdgtrsyfgafmv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4en0C (C:)
    vnpaahltganssgpllwetqlglaflrglsyhdgalvvtkagyyyiyskvqlggvgcpl
    glastithglykrtprypeelellvsqqspcgratsssrvwwdssflggvvhleageevv
    vrvlderlvrlrdgtrsyfgafmv