PDB entry 4ems

View 4ems on RCSB PDB site
Description: Crystal Structure Analysis of Coniferyl Alcohol 9-O-Methyltransferase from Linum Nodiflorum
Class: transferase
Keywords: Rossmann fold, Dimer, TRANSFERASE, small molecule O-methyltransferase, S-Adenosyl-L-methionine, coniferyl alcohol, phenylpropanoid, methylation
Deposited on 2012-04-12, released 2013-05-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-05-15, with a file datestamp of 2013-05-10.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.165
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Coniferyl alcohol 9-O-methyltransferase
    Species: Linum nodiflorum [TaxId:407264]
    Gene: CA9OMT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4emsa1, d4emsa2
  • Chain 'B':
    Compound: Coniferyl alcohol 9-O-methyltransferase
    Species: Linum nodiflorum [TaxId:407264]
    Gene: CA9OMT
    Database cross-references and differences (RAF-indexed):
    • Uniprot A6XNE6 (20-387)
      • expression tag (12-15)
      • expression tag (19)
    Domains in SCOPe 2.06: d4emsb1, d4emsb2, d4emsb3
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4emsA (A:)
    mgsshhhhhhssglvprgshmdaatavelldaqpqvwhhflgyinsmtlqcaleldiadv
    ihrhghpiplnqlaaaleipqtkapflsrlmrmlvhlgyftqvitkpedenddvlpsywl
    aplsrlllkqnpynarsltfcsvhehlvdpwrqmsawlrtgkedgkdtpnafafahegkk
    vyevcsedanfsqlfsegmagdswlfsralvskcrdafeglsslvdvgggtgntskviae
    tfpnihctvfdlphvvsgpkqthpnldyesgnmftdeiphadavlfkwvlcdwpdepvlk
    mlkqckkaltkngvkgklmiadhvldhescndsnsmgtslildmlfmsflegslrtekqw
    aklfaeagfkdykitpvgglrvlievyp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4emsA (A:)
    mdaatavelldaqpqvwhhflgyinsmtlqcaleldiadvihrhghpiplnqlaaaleip
    qtkapflsrlmrmlvhlgyftqvitkplpsywlaplsrlllkqnpynarsltfcsvhehl
    vdpwrqmsawlrtgkedgkdtpnafafahegkkvyevcsedanfsqlfsegmagdswlfs
    ralvskcrdafeglsslvdvgggtgntskviaetfpnihctvfdlphvvsgpkqthpnld
    yesgnmftdeiphadavlfkwvlcdwpdepvlkmlkqckkaltkkgklmiadhvldhesc
    ndsnsmgtslildmlfmsflegslrtekqwaklfaeagfkdykitpvgglrvlievyp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4emsB (B:)
    mgsshhhhhhssglvprgshmdaatavelldaqpqvwhhflgyinsmtlqcaleldiadv
    ihrhghpiplnqlaaaleipqtkapflsrlmrmlvhlgyftqvitkpedenddvlpsywl
    aplsrlllkqnpynarsltfcsvhehlvdpwrqmsawlrtgkedgkdtpnafafahegkk
    vyevcsedanfsqlfsegmagdswlfsralvskcrdafeglsslvdvgggtgntskviae
    tfpnihctvfdlphvvsgpkqthpnldyesgnmftdeiphadavlfkwvlcdwpdepvlk
    mlkqckkaltkngvkgklmiadhvldhescndsnsmgtslildmlfmsflegslrtekqw
    aklfaeagfkdykitpvgglrvlievyp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4emsB (B:)
    glvphmdaatavelldaqpqvwhhflgyinsmtlqcaleldiadvihrhghpiplnqlaa
    aleipqtkapflsrlmrmlvhlgyftqvitkpevlpsywlaplsrlllkqnpynarsltf
    csvhehlvdpwrqmsawlrtgkgkdtpnafafahegkkvyevcsedanfsqlfsegmagd
    swlfsralvskcrdafeglsslvdvgggtgntskviaetfpnihctvfdlpgpkqthpnl
    dyesgnmftdeiphadavlfkwvlcdwpdepvlkmlkqckkaltkgklmiadhvldhesc
    ndsnsmgtslildmlfmsflegslrtekqwaklfaeagfkdykitpvgglrvlievyp