PDB entry 4emk

View 4emk on RCSB PDB site
Description: Crystal structure of SpLsm5/6/7
Class: RNA binding protein
Keywords: Sm fold, mRNA decay and pre-mRNA splicing, Lsm proteins, RNA BINDING PROTEIN
Deposited on 2012-04-12, released 2012-06-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-06-13, with a file datestamp of 2012-06-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.232
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: U6 snRNA-associated Sm-like protein LSm5
    Species: Schizosaccharomyces pombe [TaxId:284812]
    Gene: lsm5, SPBC20F10.09
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4emka_
  • Chain 'B':
    Compound: U6 snRNA-associated Sm-like protein LSm6
    Species: Schizosaccharomyces pombe [TaxId:284812]
    Gene: lsm6, SPAC2F3.17c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4emkb_
  • Chain 'C':
    Compound: U6 snRNA-associated Sm-like protein LSm7
    Species: Schizosaccharomyces pombe [TaxId:284812]
    Gene: lsm7, SPCC285.12
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4emkA (A:)
    mgsshhhhhhsqdpmsmtilplelidkcigsnlwvimkserefagtlvgfddyvnivlkd
    vteydtvtgvtekhsemllngngmcmlipggkpe
    

    Sequence, based on observed residues (ATOM records): (download)
    >4emkA (A:)
    lplelidkcigsnlwvimkserefagtlvgfddyvnivlkdvteydtvtgvtekhsemll
    ngngmcmlipgg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4emkB (B:)
    mdsspneflnkvigkkvlirlssgvdykgilscldgymnlalerteeyvngkktnvygda
    firgnnvlyvsaldd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4emkB (B:)
    mdsspneflnkvigkkvlirlssgvdykgilscldgymnlalerteeyvngkktnvygda
    firgnnvlyvsal
    

  • Chain 'C':
    No sequence available.