PDB entry 4emg

View 4emg on RCSB PDB site
Description: Crystal structure of SpLsm3
Class: RNA binding protein
Keywords: Sm fold, mRNA decay, Lsm proteins, RNA BINDING PROTEIN
Deposited on 2012-04-12, released 2012-06-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-06-13, with a file datestamp of 2012-06-08.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.245
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable U6 snRNA-associated Sm-like protein LSm3
    Species: Schizosaccharomyces pombe [TaxId:284812]
    Gene: lsm3, SPBC9B6.05c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4emga_
  • Chain 'B':
    Compound: Probable U6 snRNA-associated Sm-like protein LSm3
    Species: Schizosaccharomyces pombe [TaxId:284812]
    Gene: lsm3, SPBC9B6.05c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4emgb_
  • Chain 'C':
    Compound: Probable U6 snRNA-associated Sm-like protein LSm3
    Species: Schizosaccharomyces pombe [TaxId:284812]
    Gene: lsm3, SPBC9B6.05c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4emgc_
  • Chain 'D':
    Compound: Probable U6 snRNA-associated Sm-like protein LSm3
    Species: Schizosaccharomyces pombe [TaxId:284812]
    Gene: lsm3, SPBC9B6.05c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4emgd_
  • Chain 'E':
    Compound: Probable U6 snRNA-associated Sm-like protein LSm3
    Species: Schizosaccharomyces pombe [TaxId:284812]
    Gene: lsm3, SPBC9B6.05c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4emge_
  • Chain 'F':
    Compound: Probable U6 snRNA-associated Sm-like protein LSm3
    Species: Schizosaccharomyces pombe [TaxId:284812]
    Gene: lsm3, SPBC9B6.05c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4emgf_
  • Chain 'G':
    Compound: Probable U6 snRNA-associated Sm-like protein LSm3
    Species: Schizosaccharomyces pombe [TaxId:284812]
    Gene: lsm3, SPBC9B6.05c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4emgg_
  • Chain 'H':
    Compound: Probable U6 snRNA-associated Sm-like protein LSm3
    Species: Schizosaccharomyces pombe [TaxId:284812]
    Gene: lsm3, SPBC9B6.05c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4emgh_
  • Chain 'I':
    Compound: Probable U6 snRNA-associated Sm-like protein LSm3
    Species: Schizosaccharomyces pombe [TaxId:284812]
    Gene: lsm3, SPBC9B6.05c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4emgi_
  • Chain 'J':
    Compound: Probable U6 snRNA-associated Sm-like protein LSm3
    Species: Schizosaccharomyces pombe [TaxId:284812]
    Gene: lsm3, SPBC9B6.05c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4emgj_
  • Chain 'K':
    Compound: Probable U6 snRNA-associated Sm-like protein LSm3
    Species: Schizosaccharomyces pombe [TaxId:284812]
    Gene: lsm3, SPBC9B6.05c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4emgk_
  • Chain 'L':
    Compound: Probable U6 snRNA-associated Sm-like protein LSm3
    Species: Schizosaccharomyces pombe [TaxId:284812]
    Gene: lsm3, SPBC9B6.05c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4emgl_
  • Chain 'M':
    Compound: Probable U6 snRNA-associated Sm-like protein LSm3
    Species: Schizosaccharomyces pombe [TaxId:284812]
    Gene: lsm3, SPBC9B6.05c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4emgm_
  • Chain 'N':
    Compound: Probable U6 snRNA-associated Sm-like protein LSm3
    Species: Schizosaccharomyces pombe [TaxId:284812]
    Gene: lsm3, SPBC9B6.05c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4emgn_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4emgA (A:)
    mesaqavaepldlvrlsldeivyvklrgdrelngrlhaydehlnmvlgdaeeivtifdde
    etdkdkalktirkhyemlfvrgdsviliapprn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4emgA (A:)
    epldlvrlsldeivyvklrgdrelngrlhaydehlnmvlgdaeeivttirkhyemlfvrg
    dsviliapprn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4emgB (B:)
    mesaqavaepldlvrlsldeivyvklrgdrelngrlhaydehlnmvlgdaeeivtifdde
    etdkdkalktirkhyemlfvrgdsviliapprn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4emgB (B:)
    epldlvrlsldeivyvklrgdrelngrlhaydehlnmvlgdaeeivttirkhyemlfvrg
    dsviliapprn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4emgC (C:)
    mesaqavaepldlvrlsldeivyvklrgdrelngrlhaydehlnmvlgdaeeivtifdde
    etdkdkalktirkhyemlfvrgdsviliapprn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4emgC (C:)
    epldlvrlsldeivyvklrgdrelngrlhaydehlnmvlgdaeeivttirkhyemlfvrg
    dsviliapprn
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4emgD (D:)
    mesaqavaepldlvrlsldeivyvklrgdrelngrlhaydehlnmvlgdaeeivtifdde
    etdkdkalktirkhyemlfvrgdsviliapprn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4emgD (D:)
    epldlvrlsldeivyvklrgdrelngrlhaydehlnmvlgdaeeivttirkhyemlfvrg
    dsviliapprn
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4emgE (E:)
    mesaqavaepldlvrlsldeivyvklrgdrelngrlhaydehlnmvlgdaeeivtifdde
    etdkdkalktirkhyemlfvrgdsviliapprn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4emgE (E:)
    epldlvrlsldeivyvklrgdrelngrlhaydehlnmvlgdaeeivttirkhyemlfvrg
    dsviliapprn
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4emgF (F:)
    mesaqavaepldlvrlsldeivyvklrgdrelngrlhaydehlnmvlgdaeeivtifdde
    etdkdkalktirkhyemlfvrgdsviliapprn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4emgF (F:)
    epldlvrlsldeivyvklrgdrelngrlhaydehlnmvlgdaeeivttirkhyemlfvrg
    dsviliapprn
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4emgG (G:)
    mesaqavaepldlvrlsldeivyvklrgdrelngrlhaydehlnmvlgdaeeivtifdde
    etdkdkalktirkhyemlfvrgdsviliapprn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4emgG (G:)
    epldlvrlsldeivyvklrgdrelngrlhaydehlnmvlgdaeeivttirkhyemlfvrg
    dsviliapprn
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4emgH (H:)
    mesaqavaepldlvrlsldeivyvklrgdrelngrlhaydehlnmvlgdaeeivtifdde
    etdkdkalktirkhyemlfvrgdsviliapprn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4emgH (H:)
    epldlvrlsldeivyvklrgdrelngrlhaydehlnmvlgdaeeivttirkhyemlfvrg
    dsviliapprn
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >4emgI (I:)
    mesaqavaepldlvrlsldeivyvklrgdrelngrlhaydehlnmvlgdaeeivtifdde
    etdkdkalktirkhyemlfvrgdsviliapprn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4emgI (I:)
    epldlvrlsldeivyvklrgdrelngrlhaydehlnmvlgdaeeivttirkhyemlfvrg
    dsviliapprn
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >4emgJ (J:)
    mesaqavaepldlvrlsldeivyvklrgdrelngrlhaydehlnmvlgdaeeivtifdde
    etdkdkalktirkhyemlfvrgdsviliapprn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4emgJ (J:)
    epldlvrlsldeivyvklrgdrelngrlhaydehlnmvlgdaeeivttirkhyemlfvrg
    dsviliapprn
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >4emgK (K:)
    mesaqavaepldlvrlsldeivyvklrgdrelngrlhaydehlnmvlgdaeeivtifdde
    etdkdkalktirkhyemlfvrgdsviliapprn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4emgK (K:)
    epldlvrlsldeivyvklrgdrelngrlhaydehlnmvlgdaeeivttirkhyemlfvrg
    dsviliapprn
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4emgL (L:)
    mesaqavaepldlvrlsldeivyvklrgdrelngrlhaydehlnmvlgdaeeivtifdde
    etdkdkalktirkhyemlfvrgdsviliapprn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4emgL (L:)
    epldlvrlsldeivyvklrgdrelngrlhaydehlnmvlgdaeeivttirkhyemlfvrg
    dsviliapprn
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >4emgM (M:)
    mesaqavaepldlvrlsldeivyvklrgdrelngrlhaydehlnmvlgdaeeivtifdde
    etdkdkalktirkhyemlfvrgdsviliapprn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4emgM (M:)
    epldlvrlsldeivyvklrgdrelngrlhaydehlnmvlgdaeeivttirkhyemlfvrg
    dsviliapprn
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >4emgN (N:)
    mesaqavaepldlvrlsldeivyvklrgdrelngrlhaydehlnmvlgdaeeivtifdde
    etdkdkalktirkhyemlfvrgdsviliapprn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4emgN (N:)
    epldlvrlsldeivyvklrgdrelngrlhaydehlnmvlgdaeeivttirkhyemlfvrg
    dsviliapprn