PDB entry 4em9

View 4em9 on RCSB PDB site
Description: Human PPAR gamma in complex with nonanoic acids
Class: transcription
Keywords: Nuclear receptor, Retinoic acid receptor, Nucleus, TRANSCRIPTION
Deposited on 2012-04-11, released 2013-03-06
The last revision prior to the SCOPe 2.02 freeze date was dated 2013-03-06, with a file datestamp of 2013-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.206
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peroxisome proliferator-activated receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: PPARG, NR1C3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d4em9a_
  • Chain 'B':
    Compound: Peroxisome proliferator-activated receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: PPARG, NR1C3
    Database cross-references and differences (RAF-indexed):
  • Heterogens: KNA, GOL, TCE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4em9A (A:)
    gshmesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedki
    kfkhitplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygv
    heiiytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnaleldds
    dlaifiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdl
    rqivtehvqllqvikktetdmslhpllqeiykdly
    

    Sequence, based on observed residues (ATOM records): (download)
    >4em9A (A:)
    esadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkskeva
    irifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiytmlaslmnkdg
    vlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaifiaviilsgdrp
    gllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivtehvqllqvikk
    tetdmslhpllqeiykdly
    

  • Chain 'B':
    No sequence available.