PDB entry 4elk

View 4elk on RCSB PDB site
Description: Crystal structure of the Hy19.3 type II NKT TCR
Class: immune system
Keywords: antigen presentation, type II NKT cells, IMMUNE SYSTEM
Deposited on 2012-04-10, released 2012-07-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-01-09, with a file datestamp of 2013-01-04.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.19
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hy19.3 TCR alpha chain (mouse variable domain, human constant domain)
    Species: Mus musculus [TaxId:10090]
    Gene: Valpha1 (mouse variable domain, human constant domain)
    Database cross-references and differences (RAF-indexed):
    • PDB 4ELK
    Domains in SCOPe 2.07: d4elka1, d4elka2
  • Chain 'B':
    Compound: Hy19.3 TCR beta chain (mouse variable domain, human constant domain)
    Species: Mus musculus [TaxId:10090]
    Gene: Vbeta16 (mouse variable domain, human constant domain)
    Database cross-references and differences (RAF-indexed):
    • PDB 4ELK (Start-243)
    Domains in SCOPe 2.07: d4elkb1, d4elkb2
  • Chain 'C':
    Compound: Hy19.3 TCR alpha chain (mouse variable domain, human constant domain)
    Species: Mus musculus [TaxId:10090]
    Gene: Valpha1 (mouse variable domain, human constant domain)
    Database cross-references and differences (RAF-indexed):
    • PDB 4ELK
    Domains in SCOPe 2.07: d4elkc1, d4elkc2
  • Chain 'D':
    Compound: Hy19.3 TCR beta chain (mouse variable domain, human constant domain)
    Species: Mus musculus [TaxId:10090]
    Gene: Vbeta16 (mouse variable domain, human constant domain)
    Database cross-references and differences (RAF-indexed):
    • PDB 4ELK (Start-243)
    Domains in SCOPe 2.07: d4elkd1, d4elkd2
  • Heterogens: ACT, FMT, MLI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4elkA (A:)
    mqqkvqqspeslsvpeggmaslnctssdrnfqyfwwyrqhsgegpkalmsifsdgdkkeg
    rftahlnkaslhvslhirdsqpsdsalyfcaaseqnnyaqgltfglgtrvsvfpyiqnpd
    pavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavaws
    nksdfacanafnnsiipedtffpspess
    

    Sequence, based on observed residues (ATOM records): (download)
    >4elkA (A:)
    qkvqqspeslsvpeggmaslnctssdrnfqyfwwyrqhsgegpkalmsifsdgdkkegrf
    tahlnkaslhvslhirdsqpsdsalyfcaaseqnaqgltfglgtrvsvfpyiqnpdpavy
    qlrdskssdksvclftdfdsqtnvsqsdsdvyitdkcvldmrsmdfksnsavawsnksdf
    acanafnnsiipedtffps
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4elkB (B:)
    mgpkvlqipshqiidmgqmvtlncdpvsnhlyfywykqilgqqmeflvnfyngkvmeksk
    lfkdqfsverpdgsyftlkiqptaledsavyfcassfwgayaeqffgpgtrltvledlrn
    vtppkvslfepskaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplke
    qpalndsryslssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaea
    wgra
    

    Sequence, based on observed residues (ATOM records): (download)
    >4elkB (B:)
    pkvlqipshqiidmgqmvtlncdpvsnhlyfywykqilgqqmeflvnfyngkvmeksklf
    kdqfsverpdgsyftlkiqptaledsavyfcassfwgayaeqffgpgtrltvledlrnvt
    ppkvslfepskaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplkeqp
    alndsryslssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeawg
    ra
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4elkC (C:)
    mqqkvqqspeslsvpeggmaslnctssdrnfqyfwwyrqhsgegpkalmsifsdgdkkeg
    rftahlnkaslhvslhirdsqpsdsalyfcaaseqnnyaqgltfglgtrvsvfpyiqnpd
    pavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavaws
    nksdfacanafnnsiipedtffpspess
    

    Sequence, based on observed residues (ATOM records): (download)
    >4elkC (C:)
    qkvqqspeslsvpeggmaslnctssdrnfqyfwwyrqhsgegpkalmsifsdgdkkegrf
    tahlnkaslhvslhirdsqpsdsalyfcaaseqnnyaqgltfglgtrvsvfpyiqnpdpa
    vyqlrdskssdksvclftdfdsqtnvsqsdsdvyitdkcvldmrsmdfksnsavawsnkd
    facanafnnsiipedtffpspes
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4elkD (D:)
    mgpkvlqipshqiidmgqmvtlncdpvsnhlyfywykqilgqqmeflvnfyngkvmeksk
    lfkdqfsverpdgsyftlkiqptaledsavyfcassfwgayaeqffgpgtrltvledlrn
    vtppkvslfepskaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplke
    qpalndsryslssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaea
    wgra
    

    Sequence, based on observed residues (ATOM records): (download)
    >4elkD (D:)
    gpkvlqipshqiidmgqmvtlncdpvsnhlyfywykqilgqqmeflvnfyngkvmekskl
    fkdqfsverpdgsyftlkiqptaledsavyfcassfwgayaeqffgpgtrltvledlrnv
    tppkvslfepskaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplkeq
    palndsryslssrlrvsatfwqnprnhfrcqvqfyglsndewtqdrakpvtqivsaeawg
    ra