PDB entry 4ek7

View 4ek7 on RCSB PDB site
Description: High speed X-ray analysis of plant enzymes at room temperature
Class: hydrolase
Keywords: Raucaffricine-O-beta-D-glucosidase, raucaffricine beta-glucosidase activity, HYDROLASE
Deposited on 2012-04-09, released 2013-02-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-02-20, with a file datestamp of 2013-02-15.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.153
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Raucaffricine-O-beta-D-glucosidase
    Species: Rauvolfia serpentina [TaxId:4060]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9SPP9 (Start-512)
      • engineered mutation (185)
    Domains in SCOPe 2.06: d4ek7a_
  • Chain 'B':
    Compound: Raucaffricine-O-beta-D-glucosidase
    Species: Rauvolfia serpentina [TaxId:4060]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9SPP9 (Start-512)
      • engineered mutation (185)
    Domains in SCOPe 2.06: d4ek7b_
  • Heterogens: BGC, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ek7A (A:)
    matqssavidsndatrisrsdfpadfimgtgssayqieggardggrgpsiwdtfthrrpd
    mirggtngdvavdsyhlykedvnilknlgldayrfsiswsrvlpggrlsggvnkeginyy
    nnlidgllangikpfvtlfhwdvpqaledeyggflsprivddfceyaelcfwefgdrvkh
    wmtlnqpwtfsvhgyatglyapgrgrtspehvnhptvqhrcstvapqcicstgnpgtepy
    wvthhlllahaaavelyknkfqrgqegqigishatqwmepwdensasdveaaaraldfml
    gwfmepitsgdypksmkkfvgsrlpkfspeqskmlkgsydfvglnyytasyvtnastnss
    gsnnfsyntdihvtyetdrngvpigpqsgsdwlliypegirkilvytkktynvpliyvte
    ngvddvkntnltlsearkdsmrlkylqdhifnvrqamndgvnvkgyfawslldnfewgeg
    ygvrfgiihidyndnfarypkdsavwlmnsfhk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ek7A (A:)
    datrisrsdfpadfimgtgssayqieggardggrgpsiwdtfthrrpdmirggtngdvav
    dsyhlykedvnilknlgldayrfsiswsrvlpggrlsggvnkeginyynnlidgllangi
    kpfvtlfhwdvpqaledeyggflsprivddfceyaelcfwefgdrvkhwmtlnqpwtfsv
    hgyatglyapgrgrstgnpgtepywvthhlllahaaavelyknkfqrgqegqigishatq
    wmepwdensasdveaaaraldfmlgwfmepitsgdypksmkkfvgsrlpkfspeqskmlk
    gsydfvglnyytasyvtnasnfsyntdihvtyetdrngvpigpqsgsdwlliypegirki
    lvytkktynvpliyvtengvddvkntnltlsearkdsmrlkylqdhifnvrqamndgvnv
    kgyfawslldnfewgegygvrfgiihidyndnfarypkdsavwlmnsfhk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4ek7B (B:)
    matqssavidsndatrisrsdfpadfimgtgssayqieggardggrgpsiwdtfthrrpd
    mirggtngdvavdsyhlykedvnilknlgldayrfsiswsrvlpggrlsggvnkeginyy
    nnlidgllangikpfvtlfhwdvpqaledeyggflsprivddfceyaelcfwefgdrvkh
    wmtlnqpwtfsvhgyatglyapgrgrtspehvnhptvqhrcstvapqcicstgnpgtepy
    wvthhlllahaaavelyknkfqrgqegqigishatqwmepwdensasdveaaaraldfml
    gwfmepitsgdypksmkkfvgsrlpkfspeqskmlkgsydfvglnyytasyvtnastnss
    gsnnfsyntdihvtyetdrngvpigpqsgsdwlliypegirkilvytkktynvpliyvte
    ngvddvkntnltlsearkdsmrlkylqdhifnvrqamndgvnvkgyfawslldnfewgeg
    ygvrfgiihidyndnfarypkdsavwlmnsfhk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ek7B (B:)
    datrisrsdfpadfimgtgssayqieggardggrgpsiwdtfthrrpdmirggtngdvav
    dsyhlykedvnilknlgldayrfsiswsrvlpggrlsggvnkeginyynnlidgllangi
    kpfvtlfhwdvpqaledeyggflsprivddfceyaelcfwefgdrvkhwmtlnqpwtfsv
    hgyatglyapgrgrstgnpgtepywvthhlllahaaavelyknkfqrgqegqigishatq
    wmepwdensasdveaaaraldfmlgwfmepitsgdypksmkkfvgsrlpkfspeqskmlk
    gsydfvglnyytasyvtnasnfsyntdihvtyetdrngvpigpqsgsdwlliypegirki
    lvytkktynvpliyvtengvddvkntnltlsearkdsmrlkylqdhifnvrqamndgvnv
    kgyfawslldnfewgegygvrfgiihidyndnfarypkdsavwlmnsfhk