PDB entry 4ehb

View 4ehb on RCSB PDB site
Description: Crystal structure of the CFTR inhibitory factor Cif with the D129S mutation bound to epoxyhexane
Class: hydrolase
Keywords: Alpha Beta Hydrolase, Epoxide Hydrolase, secreted, HYDROLASE
Deposited on 2012-04-02, released 2013-08-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative hydrolase
    Species: Pseudomonas aeruginosa [TaxId:208963]
    Gene: PA14_26090
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02P97 (0-294)
      • engineered mutation (104)
    Domains in SCOPe 2.07: d4ehba_
  • Chain 'B':
    Compound: Putative hydrolase
    Species: Pseudomonas aeruginosa [TaxId:208963]
    Gene: PA14_26090
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02P97 (0-294)
      • engineered mutation (104)
      • expression tag (295-296)
    Domains in SCOPe 2.07: d4ehbb1, d4ehbb2
  • Chain 'C':
    Compound: Putative hydrolase
    Species: Pseudomonas aeruginosa [TaxId:208963]
    Gene: PA14_26090
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02P97 (0-294)
      • engineered mutation (104)
      • expression tag (295-296)
    Domains in SCOPe 2.07: d4ehbc1, d4ehbc2
  • Chain 'D':
    Compound: Putative hydrolase
    Species: Pseudomonas aeruginosa [TaxId:208963]
    Gene: PA14_26090
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02P97 (0-294)
      • engineered mutation (104)
      • expression tag (295-296)
    Domains in SCOPe 2.07: d4ehbd1, d4ehbd2
  • Heterogens: 0PZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ehbA (A:)
    aeefpvpngfesayrevdgvklhyvkggqgplvmlvhgfgqtwyewhqlmpelakrftvi
    apdlpglgqseppktgysgeqvavylhklarqfspdrpfdlvahsigiwntypmvvknqa
    diarlvymeapipdariyrfpaftaqgeslvwhfsffaaddrlaetliagkerfflehfi
    kshasntevfserlldlyarsyakphslnasfeyyralnesvrqnaelaktrlqmptmtl
    aggghggmgtfqleqmkayaedveghvlpgcghwlpeecaapmnrlvidflsrgrhhhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ehbA (A:)
    aeefpvpngfesayrevdgvklhyvkggqgplvmlvhgfgqtwyewhqlmpelakrftvi
    apdlpglgqseppktgysgeqvavylhklarqfspdrpfdlvahsigiwntypmvvknqa
    diarlvymeapipdariyrfpaftaqgeslvwhfsffaaddrlaetliagkerfflehfi
    kshasntevfserlldlyarsyakphslnasfeyyralnesvrqnaelaktrlqmptmtl
    aggghggmgtfqleqmkayaedveghvlpgcghwlpeecaapmnrlvidflsrgr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4ehbB (B:)
    aeefpvpngfesayrevdgvklhyvkggqgplvmlvhgfgqtwyewhqlmpelakrftvi
    apdlpglgqseppktgysgeqvavylhklarqfspdrpfdlvahsigiwntypmvvknqa
    diarlvymeapipdariyrfpaftaqgeslvwhfsffaaddrlaetliagkerfflehfi
    kshasntevfserlldlyarsyakphslnasfeyyralnesvrqnaelaktrlqmptmtl
    aggghggmgtfqleqmkayaedveghvlpgcghwlpeecaapmnrlvidflsrgrhhhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ehbB (B:)
    aeefpvpngfesayrevdgvklhyvkggqgplvmlvhgfgqtwyewhqlmpelakrftvi
    apdlpglgqseppktgysgeqvavylhklarqfspdrpfdlvahsigiwntypmvvknqa
    diarlvymeapipdariyrfpaftaqgeslvwhfsffaaddrlaetliagkerfflehfi
    kshasntevfserlldlyarsyakphslnasfeyyralnesvrqnaelaktrlqmptmtl
    aggghggmgtfqleqmkayaedveghvlpgcghwlpeecaapmnrlvidflsrgrhh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4ehbC (C:)
    aeefpvpngfesayrevdgvklhyvkggqgplvmlvhgfgqtwyewhqlmpelakrftvi
    apdlpglgqseppktgysgeqvavylhklarqfspdrpfdlvahsigiwntypmvvknqa
    diarlvymeapipdariyrfpaftaqgeslvwhfsffaaddrlaetliagkerfflehfi
    kshasntevfserlldlyarsyakphslnasfeyyralnesvrqnaelaktrlqmptmtl
    aggghggmgtfqleqmkayaedveghvlpgcghwlpeecaapmnrlvidflsrgrhhhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ehbC (C:)
    aeefpvpngfesayrevdgvklhyvkggqgplvmlvhgfgqtwyewhqlmpelakrftvi
    apdlpglgqseppktgysgeqvavylhklarqfspdrpfdlvahsigiwntypmvvknqa
    diarlvymeapipdariyrfpaftaqgeslvwhfsffaaddrlaetliagkerfflehfi
    kshasntevfserlldlyarsyakphslnasfeyyralnesvrqnaelaktrlqmptmtl
    aggghggmgtfqleqmkayaedveghvlpgcghwlpeecaapmnrlvidflsrgrhh
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4ehbD (D:)
    aeefpvpngfesayrevdgvklhyvkggqgplvmlvhgfgqtwyewhqlmpelakrftvi
    apdlpglgqseppktgysgeqvavylhklarqfspdrpfdlvahsigiwntypmvvknqa
    diarlvymeapipdariyrfpaftaqgeslvwhfsffaaddrlaetliagkerfflehfi
    kshasntevfserlldlyarsyakphslnasfeyyralnesvrqnaelaktrlqmptmtl
    aggghggmgtfqleqmkayaedveghvlpgcghwlpeecaapmnrlvidflsrgrhhhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ehbD (D:)
    aeefpvpngfesayrevdgvklhyvkggqgplvmlvhgfgqtwyewhqlmpelakrftvi
    apdlpglgqseppktgysgeqvavylhklarqfspdrpfdlvahsigiwntypmvvknqa
    diarlvymeapipdariyrfpaftaqgeslvwhfsffaaddrlaetliagkerfflehfi
    kshasntevfserlldlyarsyakphslnasfeyyralnesvrqnaelaktrlqmptmtl
    aggghggmgtfqleqmkayaedveghvlpgcghwlpeecaapmnrlvidflsrgrhh