PDB entry 4egq

View 4egq on RCSB PDB site
Description: Crystal structure of D-alanine-D-alanine ligase B from Burkholderia pseudomallei
Class: ligase
Keywords: Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, SSGCID, flexible protein, ATP-dependent, magnesium dependent, cell wall biogenesis, LIGASE
Deposited on 2012-03-31, released 2012-04-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-04-11, with a file datestamp of 2012-04-06.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.212
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: d-alanine--d-alanine ligase
    Species: Burkholderia pseudomallei [TaxId:320372]
    Gene: BURPS1710b_3542, ddl
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4egqa1, d4egqa2
  • Chain 'B':
    Compound: d-alanine--d-alanine ligase
    Species: Burkholderia pseudomallei [TaxId:320372]
    Gene: BURPS1710b_3542, ddl
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4egqb1, d4egqb2
  • Chain 'C':
    Compound: d-alanine--d-alanine ligase
    Species: Burkholderia pseudomallei [TaxId:320372]
    Gene: BURPS1710b_3542, ddl
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4egqc1, d4egqc2
  • Chain 'D':
    Compound: d-alanine--d-alanine ligase
    Species: Burkholderia pseudomallei [TaxId:320372]
    Gene: BURPS1710b_3542, ddl
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4egqd1, d4egqd2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4egqA (A:)
    gpgsmsgidpkrfgkvavllggdsaerevslnsgrlvlqglrdagidahpfdpaqrplaa
    lkdegfvrafnalhggygengqiqgaldfygirytgsgvlgsalgldkfrtklvwqqtgi
    ptppfetvmrgddyaaraqdivaklgvplfvkpasegssvavekvksadalpaaleeaak
    hdkiviveksiegggeytaciaadldlplirivpagefydyhakyiandtqylipcglda
    akeaefkriarrafdvlgctdwgradfmldaagnpyflevntapgmtdhslppkaaravg
    igyselvvkvlsltld
    

    Sequence, based on observed residues (ATOM records): (download)
    >4egqA (A:)
    idpkrfgkvavllggdsaerevslnsgrlvlqglrdagidahpfdpaqrplaalkdegfv
    rafnalhggygengqiqgaldfygirytgsgvlgsalgldkfrtklvwqqtgiptppfet
    vmrgddyaaraqdivaklgvplfvkpassvavekvksadalpaaleeaakhdkiviveks
    iegggeytaciaadldlplirivpylipcgldaakeaefkriarrafdvlgctdwgradf
    mldaagnpyflevntapgmtdhslppkaaravgigyselvvkvlsltl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4egqB (B:)
    gpgsmsgidpkrfgkvavllggdsaerevslnsgrlvlqglrdagidahpfdpaqrplaa
    lkdegfvrafnalhggygengqiqgaldfygirytgsgvlgsalgldkfrtklvwqqtgi
    ptppfetvmrgddyaaraqdivaklgvplfvkpasegssvavekvksadalpaaleeaak
    hdkiviveksiegggeytaciaadldlplirivpagefydyhakyiandtqylipcglda
    akeaefkriarrafdvlgctdwgradfmldaagnpyflevntapgmtdhslppkaaravg
    igyselvvkvlsltld
    

    Sequence, based on observed residues (ATOM records): (download)
    >4egqB (B:)
    dpkrfgkvavllggdsaerevslnsgrlvlqglrdagidahpfdpaqrplaalkdegfvr
    afnalhggygengqiqgaldfygirytgsgvlgsalgldkfrtklvwqqtgiptppfetv
    mrgddyaaraqdivaklgvplfvkpasvekvksadalpaaleeaakhdkiviveksiegg
    geytaciaadldlplirivpagefydyhakyiandtqylipcgldaakeaefkriarraf
    dvlgctdwgradfmldaagnpyflevntapgmtdhslppkaaravgigyselvvkvlslt
    ld
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4egqC (C:)
    gpgsmsgidpkrfgkvavllggdsaerevslnsgrlvlqglrdagidahpfdpaqrplaa
    lkdegfvrafnalhggygengqiqgaldfygirytgsgvlgsalgldkfrtklvwqqtgi
    ptppfetvmrgddyaaraqdivaklgvplfvkpasegssvavekvksadalpaaleeaak
    hdkiviveksiegggeytaciaadldlplirivpagefydyhakyiandtqylipcglda
    akeaefkriarrafdvlgctdwgradfmldaagnpyflevntapgmtdhslppkaaravg
    igyselvvkvlsltld
    

    Sequence, based on observed residues (ATOM records): (download)
    >4egqC (C:)
    idpkrfgkvavllggdsaerevslnsgrlvlqglrdagidahpfdpaqrplaalkdegfv
    rafnalhggygengqiqgaldfygirytgsgvlgsalgldkfrtklvwqqtgiptppfet
    vmrgddyaaraqdivaklgvplfvkpaavekvksadalpaaleeaakhdkiviveksieg
    ggeytaciaadldlplirivpagefydyhakyiandtqylipcgldaakeaefkriarra
    fdvlgctdwgradfmldaagnpyflevntapgmtdhslppkaaravgigyselvvkvlsl
    tl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4egqD (D:)
    gpgsmsgidpkrfgkvavllggdsaerevslnsgrlvlqglrdagidahpfdpaqrplaa
    lkdegfvrafnalhggygengqiqgaldfygirytgsgvlgsalgldkfrtklvwqqtgi
    ptppfetvmrgddyaaraqdivaklgvplfvkpasegssvavekvksadalpaaleeaak
    hdkiviveksiegggeytaciaadldlplirivpagefydyhakyiandtqylipcglda
    akeaefkriarrafdvlgctdwgradfmldaagnpyflevntapgmtdhslppkaaravg
    igyselvvkvlsltld
    

    Sequence, based on observed residues (ATOM records): (download)
    >4egqD (D:)
    idpkrfgkvavllggdsaerevslnsgrlvlqglrdagidahpfdpaqrplaalkdegfv
    rafnalhggygengqiqgaldfygirytgsgvlgsalgldkfrtklvwqqtgiptppfet
    vmrdyaaraqdivaklgvplfvkpalpaaleeaakhdkiviveksiegggeytaciaadl
    dlplirivpagefydyhakyianqylipcgldaakeaefkriarrafdvlgctdwgradf
    mldaagnpyflevntapgmtdhslppkaaravgigyselvvkvlsltl