PDB entry 4egl

View 4egl on RCSB PDB site
Description: Crystal structure of two tandem RNA recognition motifs of Human antigen R
Class: RNA binding protein
Keywords: RRM, RNA Binding, Cytoplasm and Nucleus, RNA BINDING PROTEIN
Deposited on 2012-03-31, released 2012-05-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-05-30, with a file datestamp of 2012-05-25.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.265
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ELAV-like protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: ELAVL1, HUR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4egla1, d4egla2
  • Heterogens: SO4, GOL

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4eglA (A:)
    grtnlivnylpqnmtqdelrslfssigevesaklirdkvaghslgygfvnyvtakdaera
    intlnglrlqsktikvsyarpssevikdanlyisglprtmtqkdvedmfsrfgriinsrv
    lvdqttglsrgvafirfdkrseaeeaitsfnghkppgssepitvkfaanlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4eglA (A:)
    grtnlivnylpqnmtqdelrslfssigevesaklirdkvaghslgygfvnyvtakdaera
    intlnglrlqsktikvsyarpssevikdanlyisglprtmtqkdvedmfsrfgriinsrv
    lvdqttglsrgvafirfdkrseaeeaitsfnghkgssepitvkfa