PDB entry 4egi

View 4egi on RCSB PDB site
Description: Hsp90-alpha ATPase domain in complex with 2-Amino-4-ethylthio-6-methyl-1,3,5-triazine
Class: hydrolase/hydrolase inhibitor
Keywords: Bergerat Fold, Hydrolase, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2012-03-31, released 2012-05-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-10-17, with a file datestamp of 2012-10-12.
Experiment type: XRAY
Resolution: 1.79 Å
R-factor: 0.204
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Heat shock protein HSP 90-alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: HSP90AA1, HSP90A, HSPC1, HSPCA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4egia_
  • Heterogens: B2J, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4egiA (A:)
    gshmdqpmeeeevetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryesl
    tdpskldsgkelhinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqa
    gadismigqfgvgfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgt
    kvilhlkedqteyleerrikeivkkhsqfigypitlfvekerdkevsddeae
    

    Sequence, based on observed residues (ATOM records): (download)
    >4egiA (A:)
    dqpmeeeevetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryesltdps
    kldsgkelhinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqagadi
    smigqfgvgfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvil
    hlkedqteyleerrikeivkkhsqfigypitlfveker