PDB entry 4eg6

View 4eg6 on RCSB PDB site
Description: Trypanosoma brucei methionyl-tRNA synthetase in complex with inhibitor Chem 1325
Class: ligase/ligase inhibitor
Keywords: aminoacyl-tRNA synthetase, aaRS, MetRS, parasite, ligase, protein-inhibitor complex, Rossmann-fold, translation, nucleotide binding, Rossmann Fold, tRNA binding ATP binding, LIGASE-LIGASE INHIBITOR complex
Deposited on 2012-03-30, released 2012-09-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Methionyl-tRNA synthetase, putative
    Species: Trypanosoma brucei brucei [TaxId:999953]
    Gene: Tb10.70.6470
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q38C91
      • conflict (77)
      • engineered mutation (220-222)
      • conflict (267)
      • conflict (271)
    Domains in SCOPe 2.07: d4eg6a1, d4eg6a2
  • Chain 'B':
    Compound: Methionyl-tRNA synthetase, putative
    Species: Trypanosoma brucei brucei [TaxId:999953]
    Gene: Tb10.70.6470
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q38C91 (3-End)
      • expression tag (0-2)
      • conflict (4)
      • conflict (77)
      • engineered mutation (220-222)
      • conflict (267)
      • conflict (271)
    Domains in SCOPe 2.07: d4eg6b1, d4eg6b2, d4eg6b3
  • Heterogens: GOL, DMS, MET, SO4, 0P5, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4eg6A (A:)
    gpgsmkvekvffvtspiyyvnaaphighvystlitdvigryhrvkgervfaltgtdehgq
    kvaeaakqkqvspydfttavagefkkcfeqmdysidyfirttneqhkavvkelwtkleqk
    gdiylgryegwysisdesfltpqnitdgvdkdgnpckvslesghvvtwvseenymfrlsa
    frerllewyhanpgcivpefrrreviravekglpdlsvsraratlhnwaipvpgnpdhcv
    yvwldaltnyltgsrlrvdesgkevslvddfnelerfpadvhvigkdilkfhaiywpafl
    lsaglplpkkivahgwwtkdrkkiskslgnvfdpvekaeefgydalkyfllresgfsddg
    dysdknmiarlngeladtlgnlvmrctsakinvngewpspaayteedesliqlikdlpgt
    adhyylipdiqkaiiavfdvlrainayvtdmapwklvktdperlrtvlyitlegvrvttl
    llspilprksvvifdmlgvpevhrkgienfefgavppgtrlgpavegevlfskrstentk
    st
    

    Sequence, based on observed residues (ATOM records): (download)
    >4eg6A (A:)
    ekvffvtspiyyvnaaphighvystlitdvigryhrvkgervfaltgtdehgqkvaeaak
    qkqvspydfttavagefkkcfeqmdysidyfirttneqhkavvkelwtkleqkgdiylgr
    yegwysisdesfltpqnitdgvdkdgnpckvslesghvvtwvseenymfrlsafrerlle
    wyhanpgcivpefrrreviravekglpdlsvsraratlhnwaipvpgnpdhcvyvwldal
    tnyltgsrlrvdesgkevslvddfnelerfpadvhvigkdilkfhaiywpafllsaglpl
    pkkivahgwwtkdrkknvfdpvekaeefgydalkyfllresgfsddgdysdknmiarlng
    eladtlgnlvmrctsakinvngewpspaayteedesliqlikdlpgtadhyylipdiqka
    iiavfdvlrainayvtdmapwklvktdperlrtvlyitlegvrvttlllspilprksvvi
    fdmlgvpevhrkgienfefgavppgtrlgpavegevlfskrstent
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4eg6B (B:)
    gpgsmkvekvffvtspiyyvnaaphighvystlitdvigryhrvkgervfaltgtdehgq
    kvaeaakqkqvspydfttavagefkkcfeqmdysidyfirttneqhkavvkelwtkleqk
    gdiylgryegwysisdesfltpqnitdgvdkdgnpckvslesghvvtwvseenymfrlsa
    frerllewyhanpgcivpefrrreviravekglpdlsvsraratlhnwaipvpgnpdhcv
    yvwldaltnyltgsrlrvdesgkevslvddfnelerfpadvhvigkdilkfhaiywpafl
    lsaglplpkkivahgwwtkdrkkiskslgnvfdpvekaeefgydalkyfllresgfsddg
    dysdknmiarlngeladtlgnlvmrctsakinvngewpspaayteedesliqlikdlpgt
    adhyylipdiqkaiiavfdvlrainayvtdmapwklvktdperlrtvlyitlegvrvttl
    llspilprksvvifdmlgvpevhrkgienfefgavppgtrlgpavegevlfskrstentk
    st
    

    Sequence, based on observed residues (ATOM records): (download)
    >4eg6B (B:)
    gpgsmkvekvffvtspiyyvnaaphighvystlitdvigryhrvkgervfaltgtdehgq
    kvaeaakqkqvspydfttavagefkkcfeqmdysidyfirttneqhkavvkelwtkleqk
    gdiylgryegwysisdesfltpqnitwvseenymfrlsafrerllewyhanpgcivpefr
    rreviravekglpdlsvsraratlhnwaipvpgnpdhcvyvwldaltnyltgsrlrvdes
    gkevslvddfnelerfpadvhvigkdilkfhaiywpafllsaglplpkkivahgwwtkdr
    kkiskslgnvfdpvekaeefgydalkyfllresgfsddgdysdknmiarlngeladtlgn
    lvmrctsakinvngewpspaayteedesliqlikdlpgtadhyylipdiqkaiiavfdvl
    rainayvtdmapwklvktdperlrtvlyitlegvrvttlllspilprksvvifdmlgvpe
    vhrkgienfefgavppgtrlgpavegevlfskrst