PDB entry 4eg0

View 4eg0 on RCSB PDB site
Description: Crystal Structure of D-alanine--D-alanine ligase from Burkholderia ambifaria
Class: ligase
Keywords: Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, SSGCID, LIGASE
Deposited on 2012-03-30, released 2012-05-09
The last revision prior to the SCOPe 2.03 freeze date was dated 2012-05-09, with a file datestamp of 2012-05-04.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.175
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: d-alanine--d-alanine ligase
    Species: Burkholderia ambifaria [TaxId:398577]
    Gene: ddl, BamMC406_0490
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4eg0a1, d4eg0a2
  • Chain 'B':
    Compound: d-alanine--d-alanine ligase
    Species: Burkholderia ambifaria [TaxId:398577]
    Gene: ddl, BamMC406_0490
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4eg0b1, d4eg0b2
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4eg0A (A:)
    gpgsmsgidpkrfgkvavlfggesaerevsltsgrlvlqglrdagidahpfdpaerplsa
    lkdegfvrafnalhggygengqiqgaldfygirytgsgvlgsalgldkfrtklvwqqtgv
    ptppfetvmrgddyaaratdivaklglplfvkpasegssvavlkvktadalpaalseaat
    hdkiviveksiegggeytaciagdldlplikivpagefydyhakyvandtqylipcglpa
    eqetelkriarrafdvlgctdwgradfmldaagnayflevntapgmtdhslppkaarsig
    igyselvvkvlsltlnd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4eg0A (A:)
    idpkrfgkvavlfggesaerevsltsgrlvlqglrdagidahpfdpaerplsalkdegfv
    rafnalhggygengqiqgaldfygirytgsgvlgsalgldkfrtklvwqqtgvptppfet
    vmrgddyaaratdivaklglplfvkpasavlkvktadalpaalseaathdkiviveksie
    gggeytaciagdldlplikivptqylipcglpaeqetelkriarrafdvlgctdwgradf
    mldaagnayflevntapgmtdhslppkaarsigigyselvvkvlsltl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4eg0B (B:)
    gpgsmsgidpkrfgkvavlfggesaerevsltsgrlvlqglrdagidahpfdpaerplsa
    lkdegfvrafnalhggygengqiqgaldfygirytgsgvlgsalgldkfrtklvwqqtgv
    ptppfetvmrgddyaaratdivaklglplfvkpasegssvavlkvktadalpaalseaat
    hdkiviveksiegggeytaciagdldlplikivpagefydyhakyvandtqylipcglpa
    eqetelkriarrafdvlgctdwgradfmldaagnayflevntapgmtdhslppkaarsig
    igyselvvkvlsltlnd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4eg0B (B:)
    idpkrfgkvavlfggesaerevsltsgrlvlqglrdagidahpfdpaerplsalkdegfv
    rafnalhggygengqiqgaldfygirytgsgvlgsalgldkfrtklvwqqtgvptppfet
    vmrgddyaaratdivaklglplfvkpasvlkvktadalpaalseahdkiviveksieggg
    eytaciagdldlplikivpagefydtqylipcglpaeqetelkriarrafdvlgctdwgr
    adfmldaagnayflevntapgmtdhslppkaarsigigyselvvkvlsltl