PDB entry 4efm

View 4efm on RCSB PDB site
Description: Crystal structure of H-Ras G12V in complex with GppNHp (state 1)
Class: signaling protein
Keywords: Rossmann Fold, GTPase, GTP-binding, SIGNALING PROTEIN
Deposited on 2012-03-30, released 2012-05-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-03-12, with a file datestamp of 2014-03-07.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.188
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: gtpase hras
    Species: Homo sapiens [TaxId:9606]
    Gene: HRAS, HRAS1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01112 (5-170)
      • engineered mutation (16)
    Domains in SCOPe 2.08: d4efma_
  • Heterogens: GNP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >4efmA (A:)
gplgsmteyklvvvgavgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldi
ldtagqeeysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvg
nkcdlaartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh

    Sequence, based on observed residues (ATOM records): (download) 
    >4efmA (A:)
mteyklvvvgavgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
qeeysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdl
aartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh