PDB entry 4efe

View 4efe on RCSB PDB site
Description: crystal structure of DNA ligase
Class: ligase/ligase inhibitor
Keywords: DNA ligase, alpha-beta protein, adenylation, ligase-ligase inhibitor complex
Deposited on 2012-03-29, released 2013-04-03
The last revision prior to the SCOPe 2.02 freeze date was dated 2013-05-01, with a file datestamp of 2013-04-26.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.21
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA ligase
    Species: Enterococcus faecalis [TaxId:1351]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d4efea_
  • Heterogens: SO4, NMN, 0OV, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4efeA (A:)
    meqqpltltaattraqelrkqlnqysheyyvkdqpsvedyvydrlykelvdietefpdli
    tpdsptqrvggkvlsgfekaphdipmyslndgfskedifafdervrkaigkpvayccelk
    idglaislryengvfvrgatrgdgtvgenitenlrtvrsvpmrltepisvevrgecympk
    qsfvalneereengqdifanprnaaagslrqldtkivakrnlntflytvadfgpmkaktq
    fealeelsaigfrtnperqlcqsidevwayieeyhekrstlpyeidgivikvnefalqde
    lgftvkaprwaiaykfppeeaetlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4efeA (A:)
    pltltaattraqelrkqlnqysheyyvkdqpsvedyvydrlykelvdietefpdlitpds
    ptqrvggkvlsgfekaphdipmyslndgfskedifafdervrkaigkpvayccelkidgl
    aislryengvfvrgatrgdgtvgenitenlrtvrsvpmrltepisvevrgecympkqsfv
    alneereengqdifanprnaaagslrqldtkivakrnlntflytvadfgpmkaktqfeal
    eelsaigfrtnperqlcqsidevwayieeyhekrstlpyeidgivikvnefalqdelgft
    vkaprwaiaykfp