PDB entry 4ee9

View 4ee9 on RCSB PDB site
Description: Crystal structure of the RBcel1 endo-1,4-glucanase
Class: hydrolase
Keywords: glycosyl hydrolase family 5, cellulase, tim barrel, beta-1,4-endoglucanase, hydrolase
Deposited on 2012-03-28, released 2013-04-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-08-14, with a file datestamp of 2013-08-09.
Experiment type: XRAY
Resolution: 1.38 Å
R-factor: 0.156
AEROSPACI score: 0.72 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endoglucanase
    Species: Uncultured bacterium [TaxId:77133]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4ee9a_
  • Heterogens: TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4ee9A (A:)
    svdliginvagaeftggklpgkhgthyffppegyfeywseqgihtvrfplkwerlqpsln
    aelddvyaslvddmldqakendikvildvhnyaryrkkvigtedvpvsayqdlmeriakr
    wqghdalfaydimnepygsadklwpaaaqagidgvrkydkkrplliegaswssaarwpry
    adellklkdpadnmvfsahvyidedasgsykkgpgkdfepmigvkrvepfvnwlkehgkk
    ghigefgipndderwldamdkllaylnencipinywaagpswgnyklsiepkdgekrpqv
    allkkyaakdncsdfgpakae