PDB entry 4edx

View 4edx on RCSB PDB site
Description: Nerve Growth Factor in Complex with Fab from mouse mAb 911
Class: immune system
Keywords: cystine knot, immunoglobulin, growth/survival factor, immune system
Deposited on 2012-03-27, released 2014-04-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-08-13, with a file datestamp of 2014-08-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.209
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: light chain of FAB of murine anti-NGF
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4EDX (0-213)
    Domains in SCOPe 2.07: d4edxa1, d4edxa2
  • Chain 'B':
    Compound: heavy chain of Fab of murine anti-NGF
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4EDX (0-220)
  • Chain 'H':
    Compound: heavy chain of Fab of murine anti-NGF
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4EDX (0-220)
  • Chain 'L':
    Compound: light chain of FAB of murine anti-NGF
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4EDX (0-213)
    Domains in SCOPe 2.07: d4edxl1, d4edxl2
  • Chain 'V':
    Compound: Beta-nerve growth factor
    Species: Homo sapiens [TaxId:9606]
    Gene: Ngf, Ngfb
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4edxv_
  • Chain 'W':
    Compound: Beta-nerve growth factor
    Species: Homo sapiens [TaxId:9606]
    Gene: Ngf, Ngfb
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4edxw_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4edxA (A:)
    diqmtqttsslsaslgdrvtiscrasqdisnhlnwyqqkpdgtvklliyyisrfhsgvps
    rfsgsgsgtdysltisnleqediatyfcqqsktlpytfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'B':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4edxL (L:)
    diqmtqttsslsaslgdrvtiscrasqdisnhlnwyqqkpdgtvklliyyisrfhsgvps
    rfsgsgsgtdysltisnleqediatyfcqqsktlpytfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >4edxV (V:)
    ssshpifhrgefsvcdsvsvwvgdkttatdikgkevmvlgevninnsvfkqyffetkcrd
    pnpvdsgcrgidskhwnsycttthtfvkaltmdgkqaawrfiridtacvcvlsrkavrra
    

    Sequence, based on observed residues (ATOM records): (download)
    >4edxV (V:)
    gefsvcdsvsvwvgdkttatdikgkevmvlgevninnsvfkqyffetkcrdgcrgidskh
    wnsycttthtfvkaltmdgkqaawrfiridtacvcvlsrka
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >4edxW (W:)
    ssshpifhrgefsvcdsvsvwvgdkttatdikgkevmvlgevninnsvfkqyffetkcrd
    pnpvdsgcrgidskhwnsycttthtfvkaltmdgkqaawrfiridtacvcvlsrkavrra
    

    Sequence, based on observed residues (ATOM records): (download)
    >4edxW (W:)
    gefsvcdsvsvwvgdkttatdikgkevmvlgevninnsvfkqyffetkcrdsgcrgidsk
    hwnsycttthtfvkaltmdgkqaawrfiridtacvcvlsrka