PDB entry 4edw

View 4edw on RCSB PDB site
Description: Nerve Growth Factor in Complex with Fab from humanized version of mouse mAb 911 (tanezumab)
Class: immune system
Keywords: cystine knot, immunoglobulin, growth/survival factor, immune system
Deposited on 2012-03-27, released 2014-04-02
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-08-13, with a file datestamp of 2014-08-08.
Experiment type: XRAY
Resolution: 2.48 Å
R-factor: 0.203
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: tanezumab Fab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4EDW (0-End)
  • Chain 'L':
    Compound: tanezumab Fab light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4EDW (0-213)
    Domains in SCOPe 2.05: d4edwl1, d4edwl2
  • Chain 'V':
    Compound: Beta-nerve growth factor
    Species: Homo sapiens [TaxId:9606]
    Gene: Ngf, Ngfb
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4edwv_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4edwL (L:)
    diqmtqspsslsasvgdrvtitcrasqsisnnlnwyqqkpgkapklliyytsrfhsgvps
    rfsgsgsgtdftftisslqpediatyycqqehtlpytfgqgtkleikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >4edwV (V:)
    ssshpifhrgefsvcdsvsvwvgdkttatdikgkevmvlgevninnsvfkqyffetkcrd
    pnpvdsgcrgidskhwnsycttthtfvkaltmdgkqaawrfiridtacvcvlsrkavrra
    

    Sequence, based on observed residues (ATOM records): (download)
    >4edwV (V:)
    hrgefsvcdsvsvwvgdkttatdikgkevmvlgevninnsvfkqyffetkcrdpnvdgcr
    gidskhwnsycttthtfvkaltmdgkqaawrfiridtacvcvlsrk