PDB entry 4edh

View 4edh on RCSB PDB site
Description: The crystal structure of thymidylate kinase from Pseudomonas aeruginosa PAO1 in complex with ADP,TMP and Mg.
Class: transferase
Keywords: structural genomics, PSI-Biology, protein structure initiative, midwest center for structural genomics (MCSG), structures of Mtb Proteins Conferring Susceptibility to Known Mtb Inhibitors (MTBI), TRANSFERASE
Deposited on 2012-03-27, released 2012-05-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-05-23, with a file datestamp of 2012-05-18.
Experiment type: XRAY
Resolution: 1.32 Å
R-factor: 0.169
AEROSPACI score: 0.76 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thymidylate kinase
    Species: Pseudomonas aeruginosa PAO1 [TaxId:208964]
    Gene: PA2962, tmk
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4edha_
  • Chain 'B':
    Compound: thymidylate kinase
    Species: Pseudomonas aeruginosa PAO1 [TaxId:208964]
    Gene: PA2962, tmk
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HZN8 (3-212)
      • expression tag (0-2)
    Domains in SCOPe 2.07: d4edhb1, d4edhb2
  • Heterogens: TMP, ADP, MG, TRS, SO4, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4edhA (A:)
    snamtglfvtlegpegagkstnrdylaerlrergievqltrepggtplaerirelllaps
    depmaadtelllmfaaraqhlagvirpalargavvlcdrftdatyayqgggrglpearia
    alesfvqgdlrpdltlvfdlpveiglaraaargrldrfeqedrrffeavrqtylqraaqa
    peryqvldaglplaevqagldrllpnllerlng
    

    Sequence, based on observed residues (ATOM records): (download)
    >4edhA (A:)
    tglfvtlegpegagkstnrdylaerlrergievqltrepggtplaerirelllapsdepm
    aadtelllmfaaraqhlagvirpalargavvlcdrftdatyayqgggrglpeariaales
    fvqgdlrpdltlvfdlpveiglaraaargrldrfeqedrrffeavrqtylqraaqapery
    qvldaglplaevqagldrllpnllerln
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4edhB (B:)
    snamtglfvtlegpegagkstnrdylaerlrergievqltrepggtplaerirelllaps
    depmaadtelllmfaaraqhlagvirpalargavvlcdrftdatyayqgggrglpearia
    alesfvqgdlrpdltlvfdlpveiglaraaargrldrfeqedrrffeavrqtylqraaqa
    peryqvldaglplaevqagldrllpnllerlng
    

    Sequence, based on observed residues (ATOM records): (download)
    >4edhB (B:)
    snamtglfvtlegpegagkstnrdylaerlrergievqltrepggtplaerirelllaps
    depmaadtelllmfaaraqhlagvirpalargavvlcdrftdatyayqgggrglpearia
    alesfvqgdlrpdltlvfdlpveiglararldrfeqedrrffeavrqtylqraaqapery
    qvldaglplaevqagldrllpnllerlng