PDB entry 4ed5

View 4ed5 on RCSB PDB site
Description: Crystal structure of the two N-terminal RRM domains of HuR complexed with RNA
Class: RNA binding protein/RNA
Keywords: RRM, RNA binding, Nucleus, RNA BINDING PROTEIN-RNA complex
Deposited on 2012-03-27, released 2012-05-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-04-10, with a file datestamp of 2013-04-05.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.211
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ELAV-like protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: ELAVL1, HUR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ed5a1, d4ed5a2
  • Chain 'B':
    Compound: ELAV-like protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: ELAVL1, HUR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ed5b1, d4ed5b2
  • Chain 'C':
    Compound: 5'-r(*a*up*up*up*up*up*ap*up*up*up*u)-3'
  • Chain 'D':
    Compound: 5'-r(*a*up*up*up*up*up*ap*up*up*up*u)-3'
  • Heterogens: GOL, M2M, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ed5A (A:)
    grtnlivnylpqnmtqdelrslfssigevesaklirdkvaghslgygfvnyvtakdaera
    intlnglrlqsktikvsyarpssevikdanlyisglprtmtqkdvedmfsrfgriinsrv
    lvdqttglsrgvafirfdkrseaeeaitsfnghkppgssepitvkfaanlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ed5A (A:)
    grtnlivnylpqnmtqdelrslfssigevesaklirdkvaghslgygfvnyvtakdaera
    intlnglrlqsktikvsyarpssevikdanlyisglprtmtqkdvedmfsrfgriinsrv
    lvdqttglsrgvafirfdkrseaeeaitsfnghkppgssepitvkfaa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4ed5B (B:)
    grtnlivnylpqnmtqdelrslfssigevesaklirdkvaghslgygfvnyvtakdaera
    intlnglrlqsktikvsyarpssevikdanlyisglprtmtqkdvedmfsrfgriinsrv
    lvdqttglsrgvafirfdkrseaeeaitsfnghkppgssepitvkfaanlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ed5B (B:)
    grtnlivnylpqnmtqdelrslfssigevesaklirdkvaghslgygfvnyvtakdaera
    intlnglrlqsktikvsyarpssevikdanlyisglprtmtqkdvedmfsrfgriinsrv
    lvdqttglsrgvafirfdkrseaeeaitsfnghkppgssepitvkfaan
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.