PDB entry 4ebq

View 4ebq on RCSB PDB site
Description: Fab structure of anti-Vaccinia virus D8L antigen mouse IgG2a LA5
Class: immune system
Keywords: variable domain, constant domain, CDR, hypervariable region, neutralizing antibody, vaccinia virus, D8L envelope protein, conformational epitope, discontinuous epitope, D8L antigen binding, neutralizing mAb in presence of complement, D8L vaccinia envelope protein, papain treatment, IMMUNE SYSTEM
Deposited on 2012-03-23, released 2012-06-06
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-07-25, with a file datestamp of 2012-07-20.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.2
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: anti-Vaccinia D8L antigen monoclonal IgG2a antibody LA5, heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene: IgG2a, VAR-gene, heavy chain
    Database cross-references and differences (RAF-indexed):
    • PDB 4EBQ (0-220)
  • Chain 'L':
    Compound: anti-Vaccinia D8L antigen monoclonal IgG2a antibody LA5, light chain
    Species: Mus musculus [TaxId:10090]
    Gene: IgG2a, VAR-gene, light chain
    Database cross-references and differences (RAF-indexed):
    • PDB 4EBQ (0-212)
    Domains in SCOPe 2.05: d4ebql1, d4ebql2
  • Heterogens: GOL, CL, PO4, EDO, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download) 
    >4ebqL (L:)
qivltqspaimsafpgesvtmtcsasssvsymywyqqkpgssprlliydtsnlasgvpvr
fsgsgsgtsysltinrleaedgatyycqqwtsypltfgagtklelkradaaptvsifpps
seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
tkdeyerhnsytceathatstspivksfnrnec

    Sequence, based on observed residues (ATOM records): (download) 
    >4ebqL (L:)
qivltqspaimsafpgesvtmtcsasssvsymywyqqkpgssprlliydtsnlasgvpvr
fsgsgsgtsysltinrleaedgatyycqqwtsypltfgagtklelkradaaptvsifpps
seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
tkdeyerhnsytceathatspivksfnrnec