PDB entry 4eag

View 4eag on RCSB PDB site
Description: Co-crystal structure of an chimeric AMPK core with ATP
Class: transferase
Keywords: ampk, transferase
Deposited on 2012-03-22, released 2012-06-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-03-12, with a file datestamp of 2014-03-07.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.211
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: EG:132E8.2 protein
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: SNF1A, EG:132E8.2, SNF1A-RA, CG3051, Dmel_CG3051
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4eaga_
  • Chain 'B':
    Compound: 5'-AMP-activated protein kinase subunit beta-1
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Prkab1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80386 (1-84)
      • expression tag (0)
  • Chain 'C':
    Compound: 5'-amp-activated protein kinase subunit gamma-1
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Prkag1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4eagc1, d4eagc2
  • Heterogens: ATP, TAM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4eagA (A:)
    gphmgakwhlgirsqskpndimlevyramkalsyewkiinpyhvrvrrqnvktgkfskms
    lqlyqvdaksylldfksltndeveqgddvimesltppplsvsgvmplqptghhtmeffem
    caaliiqlar
    

    Sequence, based on observed residues (ATOM records): (download)
    >4eagA (A:)
    akwhlgirsqskpndimlevyramkalsyewkiinpyhvrvrrqnvktgkfskmslqlyq
    vdaksylldfksltlqptghhtmeffemcaaliiqlar
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4eagC (C:)
    mesvaaesapapenehsqetpesnssvyttfmkshrcydliptssklvvfdtslqvkkaf
    falvtngvraaplwdskkqsfvgmltitdfinilhryyksalvqiyeleehkietwrevy
    lqdsfkplvcispnaslfdavsslirnkihrlpvidpesgntlyilthkrilkflklfit
    efpkpefmsksleelqigtyaniamvrtttpvyvalgifvqhrvsalpvvdekgrvvdiy
    skfdvinlaaektynnldvsvtkalqhrshyfegvlkcylhetleaiinrlveaevhrlv
    vvdehdvvkgivslsdilqalvltggekkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4eagC (C:)
    svyttfmkshrcydliptssklvvfdtslqvkkaffalvtngvraaplwdskkqsfvgml
    titdfinilhryyksalvqiyeleehkietwrevylqdsfkplvcispnaslfdavssli
    rnkihrlpvidpesgntlyilthkrilkflklfitefpkpefmsksleelqigtyaniam
    vrtttpvyvalgifvqhrvsalpvvdekgrvvdiyskfdvinlaanldvsvtkalqhrgv
    lkcylhetleaiinrlveaevhrlvvvdehdvvkgivslsdilqalvlt