PDB entry 4e8l

View 4e8l on RCSB PDB site
Description: Crystal structure of streptogramin group A antibiotic acetyltransferase VatA from Staphylococcus aureus
Class: transferase
Keywords: structural genomics, antibiotic resistance, Center for Structural Genomics of Infectious Diseases (CSGID), NIAID, National Institute of Allergy and Infectious Diseases, Xenobiotic acyltransferase (XAT) family, hexapeptide repeat acyltransferase, streptogramin group A antibiotics, streptogramin A, virginiamycin, dalfopristin, acetyl coenzyme A, coenzyme A, intracellular, TRANSFERASE
Deposited on 2012-03-20, released 2012-04-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-10-16, with a file datestamp of 2013-10-11.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.211
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Virginiamycin A acetyltransferase
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: vat
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4e8la_
  • Chain 'B':
    Compound: Virginiamycin A acetyltransferase
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: vat
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4e8lb_
  • Chain 'C':
    Compound: Virginiamycin A acetyltransferase
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: vat
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4e8lc_
  • Heterogens: MG, CL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4e8lA (A:)
    mnlnndhgpdpenilpikgnrnlqfikptitnenilvgeysyydskrgesfedqvlyhye
    vigdkliigrfcsigpgttfimnganhrmdgstypfhlfrmgwekympslkdlplkgdie
    igndvwigrdvtimpgvkigdgaiiaaeavvtknvapysivggnplkfirkrfsdgviee
    wlalqwwnldmkiinenlpfiingdiemlkrkrkllddt
    

    Sequence, based on observed residues (ATOM records): (download)
    >4e8lA (A:)
    dhgpdpenilpikgnrnlqfikptitnenilvgeysyydskrgesfedqvlyhyevigdk
    liigrfcsigpgttfimnganhrmdgstypfhlfrmgwekympslkdlplkgdieigndv
    wigrdvtimpgvkigdgaiiaaeavvtknvapysivggnplkfirkrfsdgvieewlalq
    wwnldmkiinenlpfiingdiemlkrkrkll
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4e8lB (B:)
    mnlnndhgpdpenilpikgnrnlqfikptitnenilvgeysyydskrgesfedqvlyhye
    vigdkliigrfcsigpgttfimnganhrmdgstypfhlfrmgwekympslkdlplkgdie
    igndvwigrdvtimpgvkigdgaiiaaeavvtknvapysivggnplkfirkrfsdgviee
    wlalqwwnldmkiinenlpfiingdiemlkrkrkllddt
    

    Sequence, based on observed residues (ATOM records): (download)
    >4e8lB (B:)
    dhgpdpenilpikgnrnlqfikptitnenilvgeysyydskrgesfedqvlyhyevigdk
    liigrfcsigpgttfimnganhrmdgstypfhlfrmgwekympslkdlplkgdieigndv
    wigrdvtimpgvkigdgaiiaaeavvtknvapysivggnplkfirkrfsdgvieewlalq
    wwnldmkiinenlpfiingdiemlkrkrklld
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4e8lC (C:)
    mnlnndhgpdpenilpikgnrnlqfikptitnenilvgeysyydskrgesfedqvlyhye
    vigdkliigrfcsigpgttfimnganhrmdgstypfhlfrmgwekympslkdlplkgdie
    igndvwigrdvtimpgvkigdgaiiaaeavvtknvapysivggnplkfirkrfsdgviee
    wlalqwwnldmkiinenlpfiingdiemlkrkrkllddt
    

    Sequence, based on observed residues (ATOM records): (download)
    >4e8lC (C:)
    hgpdpenilpikgnrnlqfikptitnenilvgeysyydskrgesfedqvlyhyevigdkl
    iigrfcsigpgttfimnganhrmdgstypfhlfrmgwekympslkdlplkgdieigndvw
    igrdvtimpgvkigdgaiiaaeavvtknvapysivggnplkfirkrfsdgvieewlalqw
    wnldmkiinenlpfiingdiemlkrkrklld