PDB entry 4e89

View 4e89 on RCSB PDB site
Description: Crystal Structure of RnaseH from gammaretrovirus
Class: Hydrolase
Keywords: Rossmann Fold, Hydrolase
Deposited on 2012-03-19, released 2012-10-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-10-17, with a file datestamp of 2012-10-12.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.239
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNase H
    Species: Xenotropic MuLV-related virus [TaxId:373193]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4e89a_
  • Heterogens: CD, MG

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4e89A (A:)
    pdltdqpipdadytwytdgssflqegqrragaavtteteviwaralpagtsaqraelial
    tqalkmaegkklnvytdsryafatahvhgeiyrrrglltsegreiknkneilallkalfl
    pkrlsiihcpghqkgnsaeargnrmadqaareaamka