PDB entry 4e7p

View 4e7p on RCSB PDB site
Description: Crystal structure of receiver domain of putative NarL family response regulator spr1814 from Streptococcus pneumoniae in the presence of the phosphoryl analog beryllofluoride
Class: transcription regulator
Keywords: DNA binding, cytosol, TRANSCRIPTION REGULATOR
Deposited on 2012-03-18, released 2012-05-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-05-23, with a file datestamp of 2012-05-18.
Experiment type: XRAY
Resolution: 1.89 Å
R-factor: 0.188
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Response regulator
    Species: Streptococcus pneumoniae [TaxId:171101]
    Gene: rr11, spr1814
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8DNC2 (20-149)
      • expression tag (19)
    Domains in SCOPe 2.07: d4e7pa1, d4e7pa2
  • Chain 'B':
    Compound: Response regulator
    Species: Streptococcus pneumoniae [TaxId:171101]
    Gene: rr11, spr1814
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8DNC2 (20-149)
      • expression tag (19)
    Domains in SCOPe 2.07: d4e7pb1, d4e7pb2
  • Heterogens: MG, BEF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4e7pA (A:)
    mgsshhhhhhssglvprgshmkvlvaedqsmlrdamcqlltlqpdvesvlqakngqeaiq
    llekesvdiaildvempvktglevlewirsekletkvvvvttfkragyferavkagvday
    vlkersiadlmqtlhtvlegrkeyspelme
    

    Sequence, based on observed residues (ATOM records): (download)
    >4e7pA (A:)
    hmkvlvaedqsmlrdamcqlltlqpdvesvlqakngqeaiqllekesvdiaildvempvk
    tglevlewirsekletkvvvvttfkragyferavkagvdayvlkersiadlmqtlhtvle
    grkeyspelme
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4e7pB (B:)
    mgsshhhhhhssglvprgshmkvlvaedqsmlrdamcqlltlqpdvesvlqakngqeaiq
    llekesvdiaildvempvktglevlewirsekletkvvvvttfkragyferavkagvday
    vlkersiadlmqtlhtvlegrkeyspelme
    

    Sequence, based on observed residues (ATOM records): (download)
    >4e7pB (B:)
    hmkvlvaedqsmlrdamcqlltlqpdvesvlqakngqeaiqllekesvdiaildvempvk
    tglevlewirsekletkvvvvttfkragyferavkagvdayvlkersiadlmqtlhtvle
    grkeyspelme